KEGG   Ornithorhynchus anatinus (platypus): 100092899Help
Entry
100092899         CDS       T01045                                 

Definition
(RefSeq) aurora kinase A-like
  KO
K11481  aurora kinase A [EC:2.7.11.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04114  Oocyte meiosis
oaa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100092899
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100092899
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100092899
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   100092899
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100092899
Chromosome and associated proteins [BR:oaa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100092899
   Spindle formation proteins
    100092899
  Sister chromatid separation proteins
   Aurora kinases
    100092899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo YrbL-PhoP_reg APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 100092899
NCBI-ProteinID: XP_007654691
Position
Un
AA seq 303 aa AA seqDB search
NIPEKREVPSQKEAPCQKNEESKKRQWSLDDFDIGRPLGKGKFGNVYLAREKQSKFILAL
KVLFKGQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPRGEVYRE
LQKFSKFDEQRTATYITELADALSYCHSKKVIHRDIKPENLLLGSDGELKIADFGWSVHA
PSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAETYQETYRSI
SKVEYKFPGFVTDGAKDLISKLLKHNPYQRLTLKEVLEHPWITANSSKAPNSLKSQESTS
TKS
NT seq 914 nt NT seq  +upstreamnt  +downstreamnt
caaacattcctgaaaagagagaagtacctagccagaaagaggcaccttgccagaagaatg
aagaatccaaaaaacggcagtggtcattggatgactttgatatcggtcgccctctgggaa
aagggaaatttggaaatgtttacttggccagggagaaacaaagcaaatttatcctggcat
tgaaggtgctatttaaaggccaactggagaaagcaggagtcgaacatcagctgcgacgag
aagtcgaaatccagtctcatcttaggcatccaaatattctcagattatatgggtatttcc
acgatgccacccgggtttacttgattctagaatatgcacctcgtggagaagtatacagag
aacttcagaaattttctaagtttgatgaacagagaactgctacttatatcacggagttgg
ctgatgccctatcgtactgccactcgaaaaaagtgattcaccgagatattaagcctgaaa
atctgttgcttggatcagatggtgaactgaagattgctgactttggatggtctgtgcacg
ccccctcatctaggaggacaactctgtgtggcactcttgactacttgcctcctgagatga
ttgaaggacgaatgcatgatgagaaggtggatctctggagtcttggagtcctgtgttatg
aatttttagtgggcaaacctccctttgaggcagaaacctaccaagaaacttacaggagca
tttcaaaggttgaatataaatttcctggcttcgtaacggatggagctaaggatcttatct
caaaactcctgaagcataacccataccagaggctaactttaaaggaagtgctcgaacacc
cgtggatcacagcaaactcgtcgaaagcaccgaacagcctaaagagccaagagtccacca
gcacgaaatcctag

DBGET integrated database retrieval system