KEGG   Ornithorhynchus anatinus (platypus): 100093337Help
Entry
100093337         CDS       T01045                                 

Definition
(RefSeq) histone H2B type 2-E
  KO
K11252  histone H2B
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa05034  Alcoholism
oaa05203  Viral carcinogenesis
oaa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100093337
  Immune diseases
   05322 Systemic lupus erythematosus
    100093337
  Substance dependence
   05034 Alcoholism
    100093337
Chromosome and associated proteins [BR:oaa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100093337
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100093337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100093337
NCBI-ProteinID: XP_003430320
UniProt: F7DNX4
Position
Un
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcccgccaaatcggctccggcccccaagaaggggtcgaagaaagcggtgacc
aaagcgcagaagaaagacgggaagaagcgcaagcggagccgcaaggagagctactccatc
tacgtgtacaaggtgctgaagcaggtccaccccgacacgggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcttcccgc
ctggcgcactacaacaagcgctccaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system