KEGG   Ornithorhynchus anatinus (platypus): 100093403
Entry
100093403         CDS       T01045                                 

Definition
(RefSeq) procathepsin L-like
  KO
K01365  cathepsin L [EC:3.4.22.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04140  Autophagy - animal
oaa04142  Lysosome
oaa04145  Phagosome
oaa04210  Apoptosis
oaa04612  Antigen processing and presentation
oaa05205  Proteoglycans in cancer
oaa05323  Rheumatoid arthritis
oaa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100093403
   04142 Lysosome
    100093403
   04140 Autophagy - animal
    100093403
  09143 Cell growth and death
   04210 Apoptosis
    100093403
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100093403
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100093403
  09163 Immune disease
   05323 Rheumatoid arthritis
    100093403
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100093403
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oaa01002]
    100093403
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:oaa03110]
    100093403
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:oaa00537]
    100093403
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.15  cathepsin L
     100093403
Peptidases and inhibitors [BR:oaa01002]
 Cysteine peptidases
  Family C1: papain family
   100093403
Chaperones and folding catalysts [BR:oaa03110]
 Intramolecular chaperones
  Papain family
   100093403
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:oaa00537]
 Others
  100093403
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 100093403
NCBI-ProteinID: XP_001521715
Ensembl: ENSOANG00000040147
UniProt: F7CN07
Position
X5
AA seq 338 aa
MNLLVCLVSLCWGLAVSAPLGDSELDRHWKLRKNWHQKSYHEAEEGWRRTVWEENLKAIE
LHNLEQSLGLHTYRLGMNQFGDLTNEEFQEILTGERHFSKGNRINGSAFLEANFVQVPTS
VDWRDHGYVTPVKNQGHCGSCWAFSTTGALEGQLFRKSGRLISLSEQNLVDCSWQQGNQG
CHGGIVDLAFQYILENQGIDSEDCYPYTAKDTAQCTFKPECATARVTGFVDIPPHSEEAL
MKAVATVGPVSVGIDASSTSFRFYQSGIFYNPKCSSESLDHAVLVVGYGYEREDEAGKKY
WIVKNSWGKHWGDRGYVYMSKDRGNHCGIATVASYPLL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaatctgcttgtgtgtctggtgtccctgtgctggggtttagcagtcagcgctcctctg
ggtgactcagaactggacagacactggaagctacggaaaaactggcaccagaagagctac
cacgaggcggaggagggctggagaagaactgtgtgggaggagaatttaaaggcaatcgaa
ctacacaacctggagcagagcctggggctccacacctaccggctgggaatgaaccaattt
ggagacctgaccaacgaagagttccaggaaatactgaccggtgaaagacacttctccaag
ggaaacaggatcaatggctcggcgttcctggaagccaactttgtccaggtccccacatct
gtggattggcgggatcacggatacgtgactcctgtgaagaaccagggtcactgtggttcc
tgctgggcctttagcacgaccggtgccctggagggccagcttttccggaaatcgggccgt
ctgatctccctgagcgaacagaacctggtggactgctcttggcagcaagggaaccaaggc
tgccatggagggattgtggatctcgccttccagtacatcttggaaaaccagggcattgac
tcggaggattgctacccctacacggccaaggacaccgcccagtgcaccttcaagcccgag
tgtgccacggctcgtgtgactggctttgtggacatccctccccacagcgaggaggccctc
atgaaggccgtggccaccgtggggcccgtctccgtgggcatcgatgccagttccacctcc
ttccgcttctaccaatcaggaattttttacaaccccaagtgcagcagtgagagcctggat
cacgcggtcctggtggtgggctacggctacgagagagaggacgaggctggaaagaagtat
tggattgtgaagaacagttggggcaagcactggggagaccgtggctacgtttacatgtct
aaggaccggggcaaccactgtggcatcgctactgttgccagctaccctctgctgtga

DBGET integrated database retrieval system