KEGG   Ornithorhynchus anatinus (platypus): 100681003Help
Entry
100681003         CDS       T01045                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis protein 8 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oaa04131]
    100681003 (DOCK8)
Membrane trafficking [BR:oaa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100681003 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 100681003
NCBI-ProteinID: XP_028910923
Position
X5
AA seq 2101 aa AA seqDB search
MATLPTAERRAFALKINRYSSAEIRKLFTLPANLGQHHQRSVSSPAFSSLQLPPFYDPVE
PLDFEGFLMTQLNTLDAELVQELGDFTEDDLDVVLTPKECRTLQPSLPEEGVELDPHVRD
CVQTYIREWLIVNRKNQGSSETCGFRKTGSRKDFHKTLQRQTFESESLEYNESSSQAGPK
PCRVLCVSSGRTNLTSCDFDLRSLQPDQRLENLLQYVSLEDFERQNEEARRTNRQAELFA
LYPSVDEEDAVEIRPVPECPKEHLGNRILVKLHMLKFEIEIEPLFASIALYDVKERKKIS
ENFHCDLNSDQFKGFLRAHTPSVAPSSLARSAVFSVTYPSSDIYLVVKIEKVLQQGEIGD
CAEPYIVIKESDGGKSKEKVEKLKNQAESFCQRLGKYRMPFAWVPISLSSFFSVSTLERE
ITEVETMNGKGSIGERKTIAGSRRPSERSINLDDTGVGSGFKATPITVNTFFKQEGDRLS
DEDLFKFLADYKRSSSLQRRVKSIPGSLKLEISPAPEVLSSCLTPELLPVKAFSENRSRP
HREILEFPIREVYVPHTVYRNLLYVYPQRLNFANKLTSARNITIKIQFMCGEDHALPVIF
GKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGACV
ETTVGYSWLPILLNERLQIGPFCLPVALDKLPPNYSMHSPEKIPSQNPPIKWADGHKGVF
NIELQAVSSVHTQENHLEKFFTLCHSLENQVTFPIRVLDHKITEATLEHELKLSIICLNS
SCLEPLVLFLHLVLDKLFQLSVQPMIIAGQTANLSQFAFESVVAIANSLHNSKDLSKDQH
GRNCLLASYVYYVFRLPEVQREIAKPAGNTPHPDSRYNTFGRTSAATVGSKLLQTRVMSC
SNPDITAVYTSADEEVKTIMSSKVADRSCNRMSYYCQANSDTPSTTAVPRPASKKHFHEE
LALQMVVSTGMVRENVFKYAWFFFELLVKSMAQYVQNVDKRENLRRTRFSDRFKDDITTI
VNVVTSEIAALLVKPQKENEQAEKINISLAFFLYDLLSLMDRGFVFNLIKHYCNQLSAKL
NTLPTLISMRLEFLRILCSHEHYLNLNLFFMTSDTAPASPCPSISSQNSSSCSSFQDQKI
ASMFDLSPDFRQQHFLTGLLFTELTAALDAEGEGISKVQRKAISAIHSLLSSHDLDLRCI
KREVKVKIAVLYLPLVGIILDALPQLYDFTVSDARGGKSRPGGSDEEQDGGNAINQNVAL
AIAGNQFNLLKTSGTSLASLPYKQYNMLSPDTTRNLMICFLWIMKNADESLIRKWIADLP
SMQLNRILDLLFICVSCFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMK
RCRTPAGNDRFPGLNENLRWRKEQTHWRQANEKLDKSKAELDQEALISGNLATEANLIIL
DMQETIIQASSALDCKDNLLGGVLRVLVNSLSCDQSTTYLTHCFATLRALIAKFGDLLFE
EEVEQCADLCQRVLHHCSSSIDITRSQACATLYLLMRFSFGAINNFARVKMQVTMSLASL
VGKTSDFNEEYLRRSLRTILAYAEEDVDMQPTPFPVQVEELLRNLNSILSDTVKMREFQE
DPEMLMDLMYRIAKGYQTSPDLRLTWLQNMAEKHSKKKCYTEAAMCLVHAAALVAEYLSM
LEDHSYLPVGSVSFQNISSNVLEESAVSDDILSPDEDGVCSGRYFTESGLIGLLEQAAEL
FSTGGLYETVNEVYKLVIPILEAHRDFRKLTSTHDKLQKAFDSIINKGHKRMFGTYFRVG
FYGSKFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGEDSVEVIKDSAPVDKTKLDP
NKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMFTTPFTLEGRPRGELSEQYRRNTV
LTTLHAFPYIKTRINVIQKKEFILTPIEVAIEDMQKKTLELAVATHQEPPDAKMLQMVLQ
GSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITAD
QREYQQELKKNYNKLKENLRPMIERKIPELYKPVFRVSGEKRDSFHRSSFRKYETQGSQS
T
NT seq 6306 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctccccaccgcagagaggagggcgttcgccctgaaaatcaacaggtattct
tcagcagaaataagaaagctatttactcttccagccaaccttgggcagcaccatcagcga
agtgtaagttcccctgccttttcctctcttcaactgcctccgttttatgatcctgtggag
cctttggattttgaaggatttctgatgactcaactgaacaccctggatgcagaacttgta
caagaacttggtgacttcacagaagatgacttggatgttgttttgacaccaaaggaatgt
aggaccttacagccttcattaccagaagaaggggtggaattagatccccacgtcagggat
tgtgttcagacatatattcgggaatggctgattgtgaaccgaaaaaaccaaggcagttca
gaaacttgtggcttcagaaagaccggttcccgaaaagacttccacaagacactgcagaga
caaacgtttgagtcagaatccttggaatacaatgaatccagttctcaggcaggcccgaaa
ccctgcagagtgctctgtgtcagttctgggagaaccaacctcacttcctgcgactttgac
ctccgtagcctccagcctgaccagcggctggagaacctcttgcagtatgtcagcttagaa
gactttgagaggcaaaatgaagaagcccggaggaccaacaggcaggctgagctctttgcc
ctctacccatcagtggatgaggaggacgctgtggaaatccgcccagtaccagaatgccca
aaggaacacctggggaacagaattttagtcaaactgcacatgctgaagtttgagatagaa
attgaaccattgtttgcaagcatcgccctgtatgacgtcaaagagcgaaaaaagatctca
gaaaattttcactgcgacctgaattctgaccagttcaaagggttcttacgagctcataca
ccttctgttgccccctctagtctggcaagatctgcagtattctcagtcacctatccatct
tcagatatctacttggtagttaagatcgaaaaagtcctccagcagggagagattggagac
tgtgctgaaccctacatagttatcaaagagagtgatggtgggaagagtaaagaaaaggtc
gagaaattgaaaaatcaagcagaatccttctgccaacgtttggggaaatatcggatgcct
ttcgcctgggtgccaataagcttgtcaagtttctttagtgtttcaacacttgaaagggag
atcactgaggtggaaaccatgaatgggaaaggctccattggtgagaggaagacaattgcc
ggctctagaagaccttctgagagaagtatcaacttggatgacaccggcgttggatctggt
tttaaggctaccccgataactgtcaacacctttttcaaacaggaaggagatcgccttagt
gatgaagacttattcaagtttttagcagattacaaaagatcttcatccttgcagagaaga
gtcaagtcaataccaggctcacttaaactggagatttcaccagcgccagaagttcttagt
tcctgtttgactcctgagttgttaccagtgaaggccttttctgaaaatcgctctcgtcca
cacagagagattctggaattcccaattcgagaagtgtacgtcccccatactgtctacaga
aatcttctctatgtctacccgcagcgactgaattttgctaataagctgacatcggcaaga
aacattacaatcaagatacagtttatgtgtggggaagatcacgcattgccggtcatcttt
ggaaaatcaagtggtccagaatttctgcaagaagtgtacacagccgtcacatatcataac
aagtctccagatttttatgaagaagtgaaaattaaactcccagctaaactcacagtcaat
caccatctcctgttcaccttttatcatatcagttgccaacagaagcaaggagcttgtgtt
gaaaccaccgtgggatattcatggctgccaattctcttaaatgaacgtctccaaattgga
cctttctgtcttcctgtggccttagataaactgccacccaactactcgatgcattctcca
gagaaaatcccatcccagaatccccccattaaatgggctgacggacacaagggagtattt
aacattgaactgcaggctgtgtcatctgttcacacccaggaaaatcacctagaaaagttc
ttcactctgtgccactctctggaaaaccaagtcacatttcctatcagagtgctggatcat
aagatcacagaagctaccctggagcatgagttgaagctcagcataatctgcctgaactcc
tcctgccttgaacccctggtactgtttctgcatctggtgctggacaagttatttcagctc
tcggtgcagcccatgatcattgcaggccaaacagctaacctctcccagtttgcctttgaa
tccgtggttgcaatagccaacagccttcacaacagcaaagacctgagcaaggaccagcat
gggaggaactgtctcctggcttcctacgtgtattatgttttccgccttcccgaagtccaa
agagagatagcaaagccagccgggaatacccctcatccagattctcgctataacactttt
ggacgcacctctgctgccactgtgggctccaagcttttgcagacacgtgtgatgagctgc
agcaatccggatatcactgccgtatacacctctgccgacgaggaagtgaaaactatcatg
tcttccaaggttgctgaccgcagctgcaatcggatgtcttactattgccaagccaactct
gatacgccaagtaccactgcagttcccagaccagccagcaaaaagcacttccatgaggaa
cttgcactgcagatggtggtcagcactggcatggtgagagaaaacgtcttcaagtatgcc
tggttcttctttgagcttttggtgaagagcatggcccagtatgtccagaatgtggataaa
cgagaaaatcttcggagaactcgcttttcagatcgtttcaaagatgacatcaccaccatc
gttaatgtggtcacctcggagatagcagctcttttagtaaagccccagaaggaaaatgaa
caagctgaaaagatcaacatcagtctggctttcttcctgtatgatcttctttctctcatg
gatcgtggctttgtgttcaacctcattaaacattactgtaatcagctgtcggccaaactt
aataccctccctaccctgatttccatgaggctggagttcctgcgaatcctctgcagccat
gaacattacctgaatctgaatctcttcttcatgacctcagacactgcgccagcatccccc
tgtccctccatctcatcccagaattcaagttcctgctccagtttccaagaccagaagatt
gccagcatgtttgacctttcaccggactttcgccagcagcattttctgacggggcttctc
tttactgaattgactgctgcccttgatgctgagggggaagggatcagtaaagtacagagg
aaagcgatcagtgccatccacagcctgttgagttctcatgacctggacctacgctgtatc
aaacgagaggtgaaggtcaaaattgcagtcctatacctccctttggttggtatcattctg
gatgccctgccacagctctatgacttcacagtttcagatgcccgtggaggaaagagtcgt
ccaggtggttcagatgaagaacaagatggtggcaacgcaatcaaccagaacgtggccctg
gctattgcagggaaccagttcaacctgcttaagacgagcggcacatctctggcttccctg
ccatacaagcagtacaatatgctaagtccagacaccactcgcaacttgatgatctgcttc
ctttggatcatgaagaatgctgatgagagtctcattcggaagtggattgcagaccttcca
tccatgcaactcaacaggattctcgaccttctcttcatctgcgtctcttgctttgaatac
aagggaaaacaaagttctgacaaagtcagtacccaagtgcttcagaaatcaagagatgta
aaagcccggctagaggaggctttattgagaggtgaaggtgccagaggtgaaatgatgaaa
cgctgtaggacaccagcagggaatgaccggtttccaggactaaatgaaaacttgagatgg
aggaaagagcagacacattggcggcaagctaacgagaagctagataaatccaaggctgag
ttagatcaagaagccctgattagtggaaacctagccacagaagcaaatttaatcatcttg
gatatgcaggaaacaattatccaggcgagctcggctctggattgtaaagataacctgctg
ggaggggtcctgagggtcctagtgaactccctgagctgcgatcagagcaccacctatctg
actcattgctttgcgacactccgagctctcatcgccaagtttggcgacttgctgtttgag
gaggaagtggagcagtgtgctgacctgtgccaaagagtgctacatcactgcagcagcagc
atagatatcacccgtagtcaggcctgtgccaccctctacctcctgatgagattcagtttc
ggtgccatcaataattttgcaagagtgaagatgcaagtaacaatgtcattggcatcacta
gttggtaaaacatccgactttaatgaagaatatctcaggagatccttaagaactattttg
gcatatgctgaggaagatgtggatatgcagccaactcccttccctgtccaggtggaagag
ttgctccgtaatttgaacagcatcctgtccgacacagtgaagatgagagaatttcaggaa
gatccagagatgcttatggatctcatgtatagaattgccaagggataccagacgtcccct
gacttgagactaacttggctccagaatatggctgaaaaacactccaagaagaagtgctac
actgaggcagctatgtgcctggtccatgccgcggctctggtggcagaatacctgagcatg
ttagaggatcacagctacctgccagtgggaagtgtcagttttcagaatatttcttccaat
gtgttggaggaatctgcggtgtccgatgatattttgtcccctgatgaagatggtgtgtgt
tctgggaggtattttactgagagtggcctgataggactcttggaacaagcggcagaactc
ttcagcacgggaggtttgtatgagacggtcaatgaggtgtacaaacttgtcatccccatc
ctggaagctcatcgagacttcagaaaactgacctctactcatgacaagctgcaaaaggcc
tttgacagcatcataaacaagggtcacaagcgaatgtttggaacttatttccgtgttggt
ttctatggatccaaatttggtgatttagacgagcaggaatttgtttacaaagagcctgca
attaccaaactccctgagatttctcacagactggagggattttatggacaatgctttggt
gaggattctgtggaagtgattaaagactctgctcctgtggacaaaaccaagctggatcct
aataaggcctacatacaaatcacttttgtggagccatacttcgatgagtatgagatgaaa
gacagggtaacctactttgagaagaacttcaacctgcgacgcttcatgttcactacccct
ttcaccctggaagggcggcctcggggggagctgagtgagcagtacaggaggaacactgtc
ctgaccacattgcacgccttcccctacatcaaaacccggattaacgtcatccaaaagaaa
gagtttattctaacccccatcgaagtggccattgaagacatgcaaaagaagaccctagaa
ttggctgtggccactcatcaggaaccacccgatgccaagatgcttcagatggtgctgcaa
ggttcagtgggagccactgtgaatcagggaccactagaggtagcccaagtgttcttggcc
gaaattccagctgacccaaaactttaccgacatcacaacaagctgagattatgttttaag
gaattcataatgcgatgcggtgaggcagtggagaaaaacaagcgtctcattaccgcagac
cagagggagtatcagcaggaactgaaaaagaactacaacaagctgaaggagaatctcagg
ccaatgatcgagcgtaaaatccctgagctttacaagccggtcttcagggtctctggtgag
aagagggactctttccacagatctagtttcaggaaatatgaaacccagggatcccagagc
acctaa

DBGET integrated database retrieval system