KEGG   Ornithorhynchus anatinus (platypus): 103164803
Entry
103164803         CDS       T01045                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04080  Neuroactive ligand-receptor interaction
oaa04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103164803 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103164803 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 103164803
NCBI-ProteinID: XP_028923921
Position
6
AA seq 77 aa
MNPRLWMLALLLLWVTLTAVCGGPLPEASDGRELEEGHIRHLVQPKTMRNGVGPRQGGRR
KFRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatccgcggctctggatgctggctctcctcctgctctgggtcaccttgaccgcagtc
tgtggagggccactgcccgaggcttctgatggaagagaactggaggaggggcacatccgc
cacctggtgcaaccaaagaccatgaggaatggcgtgggaccccggcagggaggtcggagg
aagttccgccgacccagaccccggctctcacacaaggggccgatgcctttctga

DBGET integrated database retrieval system