KEGG   Ornithorhynchus anatinus (platypus): 103167151Help
Entry
103167151         CDS       T01045                                 

Gene name
DPP3
Definition
(RefSeq) dipeptidyl peptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oaa01002]
    103167151 (DPP3)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     103167151 (DPP3)
Peptidases [BR:oaa01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   103167151 (DPP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 103167151
NCBI-ProteinID: XP_028915972
Position
3
AA seq 740 aa AA seqDB search
MARADAQYVLPNDIGVAGLDCREAFALLSPAERLYAHHLSRAAWYGGLVVLLQTSPEAPH
IYALLGRLFEARDPERLRRSALREGLTEDEFQAFLVYAAGIYSNMGNYKSFGDTKFVPNL
PKEKLERLVLGSQAAQEHPEEIGELWRTCRDPMFSLEPRQRHLGLGDEGITTYFSGNCTL
EDAKLAQSFLDAQNLSAYNTRLFKELDEQGKPRYEVRLASVLGGDSAPDSDVTPKLKSSE
FKGSHFRVTRGDYAPILKKVVEHLEKAKAYAANGHQERMLTQYIASFTHGSIEAHKEGSR
HWIRDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNRSMSAKFGQLVESAEQLLRELP
WPPAFEKDKFLTPDFTSLDVLAFAGSGIPAGINIPNYDDIRQTDGFKNVSLGNVLAVAYA
TNREKLTFLEEEDKDLYIRWKGPSFEVQVGLHELLGHGSGKLFVQDETGAFNFDRETVIN
PETGERIASWYRSGETWDSKFSTIASSYEECRAESVGLYLGLNPQVLQIFGLGGPEAEDV
IYVNWLNMVRAGLLGLEFYTPETSSWRQAHMQARFVILRVLLEAGEGLVSVVPTAGSDGR
PDARVRLDRSKIRSVGRPALERFLRRLQVLKSTGDVAGGRELYEGYSAVTDEPPERFLTL
RDTVLLRKEARKLIVQPSTRHDGSEVQLLEYEPTAAGLIRSFSERFPEDRRELEEMLTSL
ARADAHFWKCGAETVPADKA
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggcggacgcccagtacgtcctccccaatgacatcggggtggccggcctggat
tgccgggaggcgttcgcgctgctgtcccccgcggagcggctctacgcccaccacctgtcg
cgggcggcctggtacgggggcctggtggtgctgctgcagacctcgcccgaggccccccac
atctacgccctcctcggccgcctcttcgaggcccgggaccccgagcggctccgacggtcg
gccctgcgggaggggctcaccgaggatgagtttcaggccttcctggtctatgccgctggc
atctactccaacatgggcaactacaagtccttcggcgacaccaagttcgttcccaacttg
cccaaggagaagctggagcggctggtgctggggagtcaggcggcccaagagcaccctgaa
gaaatcggggagctttggcgcacctgcagggaccccatgttttccctggaaccccggcag
cgccatctggggctgggggacgagggcatcaccacctatttctccggaaactgcaccctg
gaggatgccaagctggcccagagcttcctggacgcccagaatctcagcgcctacaacact
cggctcttcaaggagctggatgagcaagggaagccccgctacgaggtgcggctggcctcg
gtgctcggcggggattccgctccggactccgacgtgaccccgaagctgaagagctccgag
ttcaaggggagccacttccgggtgacccgaggggactacgctcccatcctgaagaaggtg
gtggagcacctggagaaggccaaggcctacgcagccaacggccaccaggagcggatgctg
acccagtacatagcgagctttacccacggttccatcgaagcgcacaaggaggggtcaaga
cactggatccgggacaaggggcccatcgtggagagttacatcggcttcatcgagagctac
cgtgacccgtttggctcccggggagagttcgaaggtttcgtggcggtggtgaacagatcc
atgagcgccaagtttgggcagctggtggagagcgcggaacagctgctgagggagctgccc
tggccccctgctttcgagaaggacaagttcctcacccccgacttcacctccctggacgtc
ctcgccttcgccggctccggcatccccgccggcatcaacatccccaactatgacgacatc
cggcagaccgacggcttcaagaacgtctccctggggaacgtgctggccgtggcctatgcc
accaaccgggagaagctcaccttcctggaagaggaggacaaggacctctacatccgctgg
aaggggccgtctttcgaggtgcaggtgggcctgcacgagctgctcggtcacggcagcggg
aagctcttcgtgcaggacgagacgggagcgttcaactttgaccgggagacggtgatcaac
cctgaaaccggagaacggatcgccagctggtaccggagcggcgagacctgggacagcaag
ttcagcaccatcgcgtccagctacgaggagtgtcgggccgagagcgtgggcctctacctg
ggcctcaacccccaagtgctccagatcttcgggctggggggccccgaggccgaagacgtg
atctacgtgaattggctcaacatggtgcgggcggggctgctcggccttgagttctacacc
cctgagacgtccagctggagacaggctcacatgcaggctcgatttgtgatcctgagggtc
ctgctggaagccggagagggcctcgtcagcgtcgtccccaccgccggctccgacgggcgc
ccggatgccagggtccgcctggatcgcagcaagatccgctcggtgggcaggcctgccctg
gaacgcttccttcgccgactccaggtgctgaagtcgacgggcgacgtggccgggggacga
gagctgtacgagggctactcggccgtcaccgacgagccccccgagcgcttcctcaccctc
agggacaccgtcctgctgcgcaaggaggcccgcaagctcatcgtgcagcccagcacccgc
cacgacggttcagaagtccagctgctggagtacgagcccaccgctgccggcctcatccgc
tccttctccgagcgcttccccgaagacaggcgggagttagaggagatgctcacgagcctg
gcccgagccgatgcccacttttggaagtgcggcgcggagaccgtgcccgccgataaagcc
tga

DBGET integrated database retrieval system