KEGG   Ornithorhynchus anatinus (platypus): 103168673Help
Entry
103168673         CDS       T01045                                 

Gene name
MARS2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00450  Selenocompound metabolism
oaa00970  Aminoacyl-tRNA biosynthesis
oaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    103168673 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103168673 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:oaa01007]
    103168673 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oaa03016]
    103168673 (MARS2)
Enzymes [BR:oaa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     103168673 (MARS2)
Amino acid related enzymes [BR:oaa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   103168673 (MARS2)
Transfer RNA biogenesis [BR:oaa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103168673 (MARS2)
 Prokaryotic type
   Other AARSs
    103168673 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 103168673
NCBI-ProteinID: XP_028922887
Position
6
AA seq 559 aa AA seqDB search
MLRAAPRRLLLPRGGPPPPPPRRRRACITTPIFYVNAAPHIGHLYSALLADALARHRRLR
DAVPVLLSTGTDEHGLKIQQAAADSGLSPPDFCQRNSARFRRLFEEADVSFGDFVRTSEG
RHRRAVEHFWARLAERDLLYKGRYRGWYCTADEAFVPQDRVAWRPDPSGDSVPVSLDSGH
PVHWTEEENYMFRLSRFRDPLLRWLRDDPAAVAPEPFRRHVLRWLREELPDLSVSRERSR
LHWGIPVPGDPTQTVYVWLDALVSYLTVTGYPGPGAADTCHVLGKDILRFHAVYWPALLL
AAGLPPPRRIRVHSHWTVGGRKMSKSLGNAVDPGACLERFTVDGFRYFLLRRGVPGRDGD
FSPEKAEGLVNAELADALGGLLNRCTAPALNPAGTFPRFRPARFAARARPEDRALVEAVA
ALPGLVAAHFDDFRVYRALEAVADCVRQANGFVQRHAPWRLGRDHPDEGPWADTVLHVAL
ESLRVFGTLLQPVVPATAHRLLSRLGVAPAERGLGAVDFLPGSRGRPCPFEGRGLGPDTG
VLFPRLGGAGGRRARDPGR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggcggcgccgaggcgcctcctcctcccgcggggggggccgccgccgcctcct
ccgcgccgccgccgggcttgcatcacgacgcccatcttctacgtgaacgcggccccgcac
atcggacacctctactccgccctgctggccgacgccctcgcccgccaccgccgcctgcgg
gacgccgtccccgtcctgctctccaccgggacggacgagcacgggctgaagatccagcag
gcggcggcggactcgggcctgtccccgccggacttctgccagcggaactcggcccggttc
cggcggctgttcgaggaggcggacgtctccttcggggacttcgtgcgcaccagcgagggg
cggcaccggcgggccgtcgagcacttctgggcccggctggccgagcgcgacctcctctac
aagggccgttaccggggctggtactgcacggccgacgaggccttcgtcccccaggaccgc
gtcgcctggcgtccggacccgtccggagacagcgtccccgtctccctggacagcggccac
ccggtgcactggacggaggaggagaactacatgttccggctgtcgcggttccgcgacccc
ctcctgcgctggctccgcgacgaccccgccgccgtggcgcccgagcccttccgccgccac
gtcctccgctggctgcgggaggagctgccggacctgtcggtgtcccgggaacgcagccgc
ctgcactgggggatccccgtgcccggggaccccacccagacggtctacgtgtggctggac
gccctggtcagctacctgacggtgacgggctaccccggcccgggcgccgccgacacctgc
cacgtgctgggcaaggacatcctgcggttccacgccgtctactggcccgccctgctgctg
gccgccgggctgcccccgccgcggaggatccgcgtccactcccactggaccgtcgggggc
cgcaagatgtccaagagcctggggaacgcggtggaccccggggcctgcctggagcgcttc
acggtggacggcttccgctacttcctcctgcgccggggcgtgcccggccgggacggggac
ttctcccccgagaaggccgaggggctggtcaacgcggagctggcggacgccctgggcggc
ctcctcaaccgctgcacggccccggccctcaaccccgcggggaccttcccccgcttccgg
cccgcccgcttcgccgcccgggcccggcccgaggaccgcgccctggtggaggcggtggcc
gccctccccggcctggtggccgcccacttcgacgacttccgcgtctacagggccctggag
gcggtggccgactgcgtccggcaggccaacggcttcgtccagcgccacgccccgtggagg
ctgggccgggaccacccggacgaggggccctgggcggacaccgtcctccacgtggccctg
gagagcctcagggtcttcgggaccctcctgcagccggtggtgcccgccacggcccaccgc
ctgctctcccggctgggcgtcgcgcccgccgagaggggcctgggcgccgtcgacttcctg
cccggcagccgcgggcggccctgccccttcgaggggagggggctgggcccggacacgggg
gtcttgttccccaggctgggcggggccggcggccggcgggcccgggaccccggccggtag

DBGET integrated database retrieval system