KEGG   Ornithorhynchus anatinus (platypus): 103168714
Entry
103168714         CDS       T01045                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00230  Purine metabolism
oaa01100  Metabolic pathways
oaa01522  Endocrine resistance
oaa04015  Rap1 signaling pathway
oaa04020  Calcium signaling pathway
oaa04022  cGMP-PKG signaling pathway
oaa04024  cAMP signaling pathway
oaa04062  Chemokine signaling pathway
oaa04072  Phospholipase D signaling pathway
oaa04114  Oocyte meiosis
oaa04211  Longevity regulating pathway
oaa04213  Longevity regulating pathway - multiple species
oaa04261  Adrenergic signaling in cardiomyocytes
oaa04270  Vascular smooth muscle contraction
oaa04371  Apelin signaling pathway
oaa04540  Gap junction
oaa04611  Platelet activation
oaa04713  Circadian entrainment
oaa04714  Thermogenesis
oaa04723  Retrograde endocannabinoid signaling
oaa04724  Glutamatergic synapse
oaa04725  Cholinergic synapse
oaa04727  GABAergic synapse
oaa04742  Taste transduction
oaa04750  Inflammatory mediator regulation of TRP channels
oaa04911  Insulin secretion
oaa04912  GnRH signaling pathway
oaa04913  Ovarian steroidogenesis
oaa04914  Progesterone-mediated oocyte maturation
oaa04915  Estrogen signaling pathway
oaa04916  Melanogenesis
oaa04918  Thyroid hormone synthesis
oaa04921  Oxytocin signaling pathway
oaa04923  Regulation of lipolysis in adipocytes
oaa04925  Aldosterone synthesis and secretion
oaa04926  Relaxin signaling pathway
oaa04927  Cortisol synthesis and secretion
oaa04928  Parathyroid hormone synthesis, secretion and action
oaa04934  Cushing syndrome
oaa04935  Growth hormone synthesis, secretion and action
oaa04970  Salivary secretion
oaa04971  Gastric acid secretion
oaa04972  Pancreatic secretion
oaa04976  Bile secretion
oaa05032  Morphine addiction
oaa05163  Human cytomegalovirus infection
oaa05166  Human T-cell leukemia virus 1 infection
oaa05200  Pathways in cancer
oaa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103168714 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103168714 (ADCY4)
   04371 Apelin signaling pathway
    103168714 (ADCY4)
   04020 Calcium signaling pathway
    103168714 (ADCY4)
   04072 Phospholipase D signaling pathway
    103168714 (ADCY4)
   04024 cAMP signaling pathway
    103168714 (ADCY4)
   04022 cGMP-PKG signaling pathway
    103168714 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103168714 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103168714 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103168714 (ADCY4)
   04062 Chemokine signaling pathway
    103168714 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    103168714 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    103168714 (ADCY4)
   04912 GnRH signaling pathway
    103168714 (ADCY4)
   04913 Ovarian steroidogenesis
    103168714 (ADCY4)
   04915 Estrogen signaling pathway
    103168714 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    103168714 (ADCY4)
   04921 Oxytocin signaling pathway
    103168714 (ADCY4)
   04926 Relaxin signaling pathway
    103168714 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    103168714 (ADCY4)
   04918 Thyroid hormone synthesis
    103168714 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    103168714 (ADCY4)
   04916 Melanogenesis
    103168714 (ADCY4)
   04925 Aldosterone synthesis and secretion
    103168714 (ADCY4)
   04927 Cortisol synthesis and secretion
    103168714 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103168714 (ADCY4)
   04270 Vascular smooth muscle contraction
    103168714 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    103168714 (ADCY4)
   04971 Gastric acid secretion
    103168714 (ADCY4)
   04972 Pancreatic secretion
    103168714 (ADCY4)
   04976 Bile secretion
    103168714 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    103168714 (ADCY4)
   04727 GABAergic synapse
    103168714 (ADCY4)
   04725 Cholinergic synapse
    103168714 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    103168714 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    103168714 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    103168714 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    103168714 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    103168714 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103168714 (ADCY4)
   04714 Thermogenesis
    103168714 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103168714 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    103168714 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    103168714 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103168714 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103168714 (ADCY4)
   05163 Human cytomegalovirus infection
    103168714 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103168714 (ADCY4)
Enzymes [BR:oaa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103168714 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 103168714
NCBI-ProteinID: XP_028934251
Position
13
AA seq 1086 aa
MRACTGRPQAAPETLPGSCPLPTGTNPRLSQQYPLLLLLLAILLAALAALLAITWASGPT
LGSDPAFVSTVLVAVGGFSLLLVLASREQRLQSCTRPVSGLVWAALLALGHGFLFTGGTV
SAWDQVSFFLFIIFTVYTMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQHGPPEPKLKQL
AANAVLFLCGNAAGAYHKALMERALRATFREALRSLHSRRRLDSEKRHQEHLLLSILPAY
LAREMKAEIMARLQAGQGPRPEGTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKEL
VLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHALNCVRMGLDMCRAIRK
LRAATGVEISMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGAT
LALLGGAYAVEDAAPGQRDAYLRELGETTYLVIDPRAEEEEEEGAGTPGGPLSSAEGTTM
RPSLLMTRYLESWGAAKPFANLSHLHSPGPAAPPGGRDSLQEIVLGSLNPQRSLDRARTP
RGLEDELDTEFFQVIEQLNSQKQWKRSKDFNPVTLYFRKKEMEKEYRLSALPAFKYYAAC
TFLVFLSNFTIQMLVANRPPALVIAYGIAFLLFLLLLFTCFAEHLTRCVLKGPKLLHWLP
ELSGAVANRPGLRVALGIATIVIVLTMAVANLLFLPVTDCPFSTPNASFVATNASWEHPD
FLPLISFPYCMHCSVLGFLSCSLFLHMSFELKLLLLLLWLLVSCSLFLQSHAWLSDCLVG
LLYPPPSARRPGVLKEPKLMGAFSFFVFFFTLLALARQNEYYCRLDFLWKKKLRQEREET
ETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASIPDFKEFYSESNV
NREGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDTER
SCSHLGTMVEFAVALGAKLDVINKHSFNSFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTV
NVASRMESTGVMGKIQVTEETAQALQSLGYTCYSRGVITVKGKGQLRTYFLSTELARAGP
PGPTLS
NT seq 3261 nt   +upstreamnt  +downstreamnt
atgagagcttgtaccggaagaccccaggccgctccggagaccctgccaggctcctgcccg
ctgcccaccgggaccaacccgcgcctcagccagcagtacccgctgctcctcctgctgctc
gccatcctgctcgccgcgctggccgccctgctcgccatcacctgggccagcggaccgacc
ctgggctcggacccggccttcgtgtccacggtgctggtggccgtgggcgggttctcgctg
ctgctggtgctggcttcgcgggagcagaggctgcagagctgcactcgcccggtgtcgggc
ctagtgtgggccgccctgctcgccctgggccacggcttcctcttcaccgggggcaccgtc
agcgcctgggaccaggtgtccttcttcctcttcatcatcttcaccgtgtacaccatgctg
ccgctgggcatgagggacgcggcggtcgccggcctggcctcgtccctgtcgcacctcctg
gtccttgggctgtacctcggtcctcagcacggacccccggagcccaagctcaaacagctg
gcggccaacgcggtgctgttcttgtgcgggaacgcggccggggcctatcacaaggcgctg
atggagcgcgccctgagggccaccttccgagaagcgctgcgctccctgcactcccggcga
cgcctggactcagagaagcgccaccaggagcacctgctgctgtccatcctgcccgcctac
ctggcccgggagatgaaagcggagatcatggcgcggctgcaggccggacagggcccgcgg
cccgaaggcaccaacaacttccacagtctctacgtcaagaggcaccagggcgtcagcgtg
ctgtatgcggacatcgtgggcttcacaaggctggccagcgagtgctcgcccaaggagctg
gtgttgatgctcaatgagctctttggcaagttcgaccagatcgccaaggagcacgagtgc
atgcgaatcaagatcctgggcgactgttactactgcgtgtccgggctgccgctctcgctg
ccggaccacgcgctcaactgcgtgcggatggggctggacatgtgccgggccatccggaag
ctgcgggcggccaccggggtggagatcagcatgcgcgtgggggtccactcgggcagcgtg
ctctgcggggtcatcggcctgcagaagtggcagtacgacgtctggtcccacgacgtcacc
ctggctaatcacatggaggccgggggggtgcccgggcgggtacacatcacaggggcgacc
ctggccctgctgggcggggcctacgcggtggaggatgcggcccccggacaacgtgacgcc
tacctgagagagctgggggagaccacctacctggtcattgacccccgggcggaggaggaa
gaagaggagggggcagggaccccgggggggccgctgtcttcggccgagggcaccacgatg
cgtccatcgctgctgatgacccgctacctggagtcctggggcgccgccaagccctttgcc
aacctcagccacctgcacagccccggacctgcggcgcccccggggggacgtgactccctc
caggagattgtcctaggttcgttgaacccccagaggagcttggaccgggcccgcaccccc
cgaggcctggaggatgagttggacaccgagttctttcaggtcatcgaacaactcaactcc
cagaaacagtggaagagatccaaggacttcaacccagtgaccctctacttcaggaagaag
gagatggagaaggagtaccggctctcggctctgccggctttcaaatactacgcggcctgc
actttcctggttttcctgtccaacttcaccatccagatgctggtggccaaccggccccca
gctctggtcatcgcctatggcatcgccttcctcctcttcctcctcctccttttcacctgc
tttgcagagcatctgacgaggtgcgtcctgaagggtcccaagctgctccactggctgccc
gagctgtcgggggcagtggccaatcgtccggggctccgggtggccttagggatcgccacc
atcgtcatcgttctcaccatggccgtcgccaacctgctcttcctaccagtgaccgactgc
cctttctcgacccctaacgcctccttcgtggctaccaacgcgtcttgggagcaccctgac
ttccttcccctcatcagcttcccgtattgcatgcactgttccgttctgggcttcctctcc
tgctccctcttcctgcacatgagcttcgagctgaagctgctgctgctgctgttatggctg
ctggtctcctgcagcctcttcctgcagagccacgcctggctgtccgactgcctcgtcggc
ctcctctacccgcccccctcggcccgaagaccgggggtgctgaaggagcccaagctgatg
ggcgctttttccttcttcgtcttcttcttcaccctcctggcgctggctcgacagaacgag
tattactgccgcctggacttcctatggaagaagaaactgaggcaggagcgtgaggagacg
gagaccatggagaacctgacccggctcctgttggagaacgtcttacccgcccacgtggcc
ccacagttcatcggccagaatcgccgcaatgaggacctgtaccaccagtcttacgagtgt
gtctgcgtcctcttcgcctccattcccgacttcaaggagttttattccgagtccaacgtc
aatcgggaagggctggagtgtctacggctgctcaacgagatcatcgctgactttgacgag
ctgctgtccaaacccaagttcagtggtgtggagaagatcaaaaccataggcagcacgtac
atggctgccacggggttaaatgccacgtcagggcaggatgcccagcaggacacagagcga
agctgtagccacctgggcaccatggtggagttcgccgtggccttgggggccaagctggac
gtgatcaacaagcactcgttcaacagtttccgcctgcgtgttgggctgaaccacgggcca
gtggtggcgggggtgattggggcccagaagccgcagtacgacatctggggcaacacggtg
aacgtggccagccgcatggagagcacgggcgtcatgggcaagatccaggtgaccgaggag
acggcccaggccctgcagagcctgggttatacctgctacagccggggggtcatcaccgtc
aagggcaaagggcaactccggacctacttcctgtccactgagctggctcgggctggaccc
ccgggacccacgctcagctga

DBGET integrated database retrieval system