KEGG   Ornithorhynchus anatinus (platypus): 114809986Help
Entry
114809986         CDS       T01045                                 

Gene name
ESRRA
Definition
(RefSeq) steroid hormone receptor ERR1
  KO
K08552  estrogen-related receptor alpha
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oaa03000]
    114809986 (ESRRA)
   03029 Mitochondrial biogenesis [BR:oaa03029]
    114809986 (ESRRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:oaa03310]
    114809986 (ESRRA)
Transcription factors [BR:oaa03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    114809986 (ESRRA)
Mitochondrial biogenesis [BR:oaa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    114809986 (ESRRA)
Nuclear receptors [BR:oaa03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   114809986 (ESRRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 114809986
NCBI-ProteinID: XP_028914932
Position
3
AA seq 428 aa AA seqDB search
MSVRERAAEPLYIKAEPASPDSPRGSSETEPDPPPARPPGPAPARRRPPPPGRGEEDEGE
GTGPGERGGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCP
ASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVEPLTFPGPF
PAAPLAAPGGPRKAAPVNALVSHLLVAEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIV
VTISWAKSIPGFSALSLSDQMSVLQSVWMEVLVLGVAQRSLPLRDELAFAEDLVLDEEGA
RAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHE
ALLEYEAGRVGGGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFL
EMLEAMMD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtccgggagcgggccgcggagcccctgtatatcaaggcggagcccgccagcccg
gatagcccccgcggctcctcggagacggagcccgaccccccgccggcccggccccccggc
ccggccccggcccggcgccgccccccgccccccggccggggagaggaggacgagggggaa
gggacgggacccggagagcggggcggcgggggcaagctggtgctcagctccctgcccaag
cgactctgcctggtgtgcggggacgtggcctccggctaccactacggcgtggcctcctgc
gaggcctgcaaggccttcttcaagcggaccattcaggggagcatcgagtacagctgcccg
gcctccaacgagtgcgagatcaccaagcggcgccgcaaggcctgccaggcctgccgcttc
accaagtgcctgcgggtcggcatgctcaaagagggggtccgcctggaccgggtccggggc
gggaggcagaagtacaagcgtcggcccgaggtggaaccgctgactttccccggccccttc
ccggccgcccccctggcggcgcccggcgggccccggaaggcagcgcccgtcaacgccttg
gtgtcccacctgctggtggcggagcccgagaagctgtacgccatgcccgaccccgcgggc
cccgacggacacctgccggccgtggccaccctgtgcgacctcttcgaccgggagatcgtg
gtgaccatcagctgggccaagagcatcccaggcttctcggccctgtcgctgtcggaccag
atgtcggtgctgcagagcgtgtggatggaggtgctggtgctgggcgtggcccagcgctcc
ctgcccctgcgcgacgagctggccttcgccgaggacctggtgctggacgaggagggggcc
cgggccgccgggctgggcgagctgggggccgcgctgctgcagctggtgaggcggctccag
gccctgcggctcgagcgggaggagtacgtcctgctcaaggccctggccctggccaattcc
gactcggtgcacatcgaggacgccgaagccgtggagcagctgcgggaggccctgcacgag
gccctgctggagtacgaggccggacgggtcgggggcgggcccggcgggggagccgagcgc
cggcgagccggccggctgctgctcaccctgcccctgctgcggcagacggccggcaaagtc
ctggcccacttctacggggtgaagctggagggaaaggtccccatgcataagctcttcctg
gagatgctggaggccatgatggactga

DBGET integrated database retrieval system