KEGG   Ornithorhynchus anatinus (platypus): 114810169
Entry
114810169         CDS       T01045                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00100  Steroid biosynthesis
oaa01100  Metabolic pathways
Module
oaa_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    114810169 (TM7SF2)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     114810169 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 114810169
NCBI-ProteinID: XP_028916424
Position
3
AA seq 422 aa
MAAANRRAPTPPQLEFGGPLGSALLLLLLPATLFHLLLTCRSGPCSLLSLPAPLPAPHAF
WSPRALLLLLGWLGLQAALYLLPLGPVAEGTRLPDHTRLRYPVNGFRALGATAALVGAGL
AAGLPLDALVDLLLPLASAAALTAAALSVFLYLKARRAPPCALAPGGNTGHPLYDFFLGR
ELNPRVGAFDLKYFCELRPGLMGWALLNLALLLREAELRGGRPSLAMGLVNAFQLLYVAD
ALWHEEAVLTAVDVTHDGFGFMLAFGDLAWVPFTYSLQAQFLLGHPQPLGLPAACAICLL
DAIGYYIFRGANSQKNIFRRDPTDPRVAGLQTIPTATGRRLLVSGWWGLVRHPNYLGDLI
MALAWSLPCGVTHLLPYFYVLYFTALLVHREARDERQCLRKYGLAWRDYCRRVPYRILPY
VY
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggccgccgccaaccgccgcgcccccaccccgccgcagctggaattcggggggcccctg
ggctcggccctgctgctgctgctgctcccggccaccctgttccacctgctgctgacctgc
cggtcggggccctgcagcctgctgagcctgcccgccccgctgcccgccccgcacgccttc
tggagcccccgggcgctgctgctgctgctcggctggctgggcctgcaggccgccctctac
ctgctgcccctcggaccggtggcggagggcacgcggctcccggaccacacccgcctgcgc
tatcccgtcaacggcttccgggccctgggagccacggcggcgctggtgggcgcggggctg
gcggcggggctgcccctggacgccctggtcgacctgctcctgcccctggcctcggccgcc
gccctcacggccgcggccctcagcgtcttcctctacctcaaggcccggcgggccccgccc
tgcgccctggcgccggggggcaacacaggccacccgctctacgacttcttcctgggccgc
gagctgaacccccgcgtcggcgccttcgacctcaagtacttctgtgagctgcggcccggt
ctcatgggctgggccctgctgaacctggccctgctgctgcgggaggccgagctgcggggg
ggccggccctctctggccatgggcctggtcaacgccttccagctgctctacgtggccgac
gccctctggcacgaggaggccgtgctcaccgccgtggacgtcacccacgacggcttcggc
ttcatgctggccttcggggacctggcctgggtgcccttcacctacagcctccaggcgcag
ttcctgctgggccacccgcagcccctggggctccccgccgcctgcgccatctgcctgctc
gacgccatcggctactacatcttccgaggggccaactcgcagaagaacatcttccgcagg
gacccgacggacccccgggtggccggcctccagaccatccccacggcgaccggacggcgg
ctcctggtgtccggctggtgggggctggtccgtcaccccaactacctcggggacctcatc
atggccctggcctggtccctgccctgcggcgtcacccacctcctgccctacttctacgtc
ctctacttcacggccctgctggtgcaccgcgaggcccgcgacgagcgccagtgtctgcgc
aagtacggcctggcctggcgcgactactgccggcgcgtgccctaccgcatcctgccctac
gtctactga

DBGET integrated database retrieval system