KEGG   Ornithorhynchus anatinus (platypus): 791109
Entry
791109            CDS       T01045                                 
Symbol
CRYAB
Name
(RefSeq) alpha-crystallin B chain
  KO
K09542  crystallin, alpha B
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04141  Protein processing in endoplasmic reticulum
oaa04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    791109 (CRYAB)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    791109 (CRYAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:oaa03110]
    791109 (CRYAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oaa04147]
    791109 (CRYAB)
Chaperones and folding catalysts [BR:oaa03110]
 Heat shock proteins
  HSP20
   791109 (CRYAB)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   791109 (CRYAB)
SSDB
Motif
Pfam: HSP20 Crystallin ArsA_HSP20
Other DBs
NCBI-GeneID: 791109
NCBI-ProteinID: NP_001229681
Position
11:57046583..57049469
AA seq 182 aa
MDIAIHHPWIRRPFWPFPTSSRIFDQGFGEHLLDSDLFPTSFPAFPTSFPALSSCYLRPS
FLRPSSWIDTGLSEMRLEKDKFSVNLDVKHFSPEDLKVKVLGDVIEVHGQHEERQDEHGF
ISREFHRKYRLPADVDALAITSSLSSDGVLSVTGPRKQAAGPERTIPIKREEKPAVTAAP
RK
NT seq 549 nt   +upstreamnt  +downstreamnt
atggacatcgccatccaccacccctggatccgccggcccttctggcccttccccacgtcc
agccgcatcttcgaccagggcttcggggaacacctcctggactcggacctgttccccact
tctttcccggccttccccacctccttcccggccctgagctcctgctacctgaggccctcc
ttcctccggccgtccagctggatcgacactggactctccgagatgcgactggagaaggac
aagttctccgtgaacctggacgtgaaacacttctccccggaggacctcaaagtcaaggtg
ctgggggacgtgattgaggtgcacggccagcacgaggagcgccaggacgagcacggcttc
atctcccgcgagttccaccggaagtaccggctcccggccgacgtggacgccctcgccatc
acctcgtccctgtcatccgacggggtgctgagcgtgaccggcccccggaagcaggccgcc
ggccccgagcgcaccatccccatcaagcgggaggagaagcccgccgtgaccgcggccccc
cgcaagtag

DBGET integrated database retrieval system