KEGG   Oscillatoria acuminata: Oscil6304_0922Help
Entry
Oscil6304_0922    CDS       T02368                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
oac  Oscillatoria acuminata
Pathway
oac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
oac01100  Metabolic pathways
oac01110  Biosynthesis of secondary metabolites
oac01130  Biosynthesis of antibiotics
oac01230  Biosynthesis of amino acids
Module
oac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oscil6304_0922
Enzymes [BR:oac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Oscil6304_0922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG NanE His_biosynth NMO FMN_dh
Motif
Other DBs
NCBI-ProteinID: AFY80654
UniProt: K9TF56
Position
1126928..1127809
Genome map
AA seq 293 aa AA seqDB search
MPNIRRRPPNPAVGVKSMRYQIQVPDAEPRHILEEIVWHKEIEVEAWRDRQPLLELQKLL
QAVPAPKDFLGALVSASKQPAAIAEIKKASPSKGVIREDFDPVAIAQSYQKGGAACLSVL
TDSKFFQGSFDYLKAVREVVDLPLLCKDFIIYPYQIYLARVNGADAVLLIAAILSEKDLQ
YFIKIAKALGVTPLIEVHTLEELDRVLSLDGVTLIGINNRNLEDFTVDLGTTCQLLEQRR
DRLENIIVVSESGLQTPDDLKRVVDAGAKAVLIGEAFMKQPDPGEALAAIFPE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattcgccgccgtcctcccaatcctgctgttggcgtcaagtcgatgcgctat
caaatccaggttcctgatgctgaacctcgacatattctcgaagaaatcgtttggcataaa
gaaatagaagtagaagcatggcgcgatcgccagcctttgctagagttacaaaaactcctc
caggcagtccctgcaccgaaggattttctgggggccttggtgtcagcctccaaacaaccg
gcggcgatcgcggaaattaaaaaagcctctcccagcaaaggagtcatccgcgaagacttc
gacccggtggcgatcgcccaatcttaccaaaaaggtggggccgcttgtctctcggtcctc
accgatagtaaattctttcaaggcagttttgactacctcaaagcagtccgtgaagtcgtg
gatttacccttactttgtaaagacttcatcatctatccctatcaaatttatctggcccgg
gtgaatggggcggatgcggtattgctgattgctgcaatcctctccgagaaagacttacag
tattttattaaaattgccaaagcattaggagtaactcccctaattgaagtgcataccctg
gaagaactggaccgagttttatccttagatggagttaccttaattggcattaataatcgc
aacctggaagattttaccgtcgatttaggcacaacctgtcaactgctggaacaacggcgc
gatcgcctggaaaatatcatcgtggtcagcgaatcgggactccagacccctgatgacctc
aagcgggtggtcgatgccggtgctaaagcggtgttgattggggaagcctttatgaaacaa
ccggacccaggggaagccctcgctgctatttttcccgagtaa

DBGET integrated database retrieval system