KEGG   Oscillatoria acuminata: Oscil6304_0955Help
Entry
Oscil6304_0955    CDS       T02368                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
oac  Oscillatoria acuminata
Pathway
oac00630  Glyoxylate and dicarboxylate metabolism
oac00710  Carbon fixation in photosynthetic organisms
oac01100  Metabolic pathways
oac01110  Biosynthesis of secondary metabolites
oac01120  Microbial metabolism in diverse environments
oac01130  Biosynthesis of antibiotics
oac01200  Carbon metabolism
Module
oac_M00165  Reductive pentose phosphate cycle (Calvin cycle)
oac_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
oac_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:oac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Oscil6304_0955
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Oscil6304_0955
Enzymes [BR:oac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Oscil6304_0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFY80686
UniProt: K9TEX6
Position
complement(1163939..1165369)
Genome map
AA seq 476 aa AA seqDB search
MSYSSTQTQAKTGYQAGVKDYRLTYYTPDYTPKDTDVLAAFRMTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEAVPNEENQYIAYVAYPLDLFEEGSVTNMLTS
IVGNVFGFKALRALRLEDMRIPVAYLKTFQGPPHGIQVERDKINKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFVADAIHKAQAETGEIKGHY
LNVTAPTCEEMLKRAEFAKELKMPIIMHDFLTAGFTANTTLAHWCRDNGILLHIHRAMHA
VIDRQKNHGIHFRLLAKCLRMSGGDHIHTGTVVGKLEGERGITMGFVDLLRENYIEQDKS
RGIYFTQDWASMPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEACVQARNEGRSLAREGNDILREAGRWSPELAVALDLWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacagttcaacccagactcaagcaaaaaccggctaccaagctggtgttaaagat
tatagactgacttactacacgccggattacactcccaaagataccgacgtcttggcagca
ttccggatgacccctcagcccggagttcccccggaagaagcaggagctgccgtagctgct
gaatcttctaccggaacctggaccacagtgtggaccgacctcttgaccgacttggatcgg
tacaaaggccgttgctacgacatcgaagcggtacccaacgaagagaaccaatatatcgct
tacgttgcctaccccctcgacttgtttgaggaaggttctgttaccaatatgctgacctcc
atcgtggggaacgtctttggtttcaaagccttgcgtgcactgcgcttggaagatatgcgg
attcccgttgcctacctgaagaccttccaaggtcctccccacggcatccaagttgagcgt
gacaaaatcaacaaatatggtcgtcccctgttgggttgcaccatcaagccgaaactcggt
ttatctgcgaagaactacggtcgtgcagtatatgaatgcttgcgcggtggtttggacttc
accaaagacgacgaaaacatcaactcccagccgttccaacgctggcgcgatcgcttcttg
ttcgtggctgacgctatccataaagctcaggcagaaactggcgaaatcaagggccactac
ctcaacgtaaccgcccccacctgcgaagaaatgctgaaacgggctgagttcgccaaagaa
ctcaaaatgcccatcatcatgcatgacttcttaaccgcagggttcaccgccaacaccacc
ttggctcactggtgccgcgataacggaatcctgttgcacatccaccgtgccatgcacgcc
gttatcgaccgtcagaaaaatcatggtatccacttccgtctgcttgccaagtgcttgcgg
atgtctggtggtgaccacatccacaccggaaccgttgtgggtaaactcgaaggcgaacgc
ggcattacgatgggcttcgtcgatctgctccgcgaaaactatatcgaacaagataaatct
cgtgggatttacttcacccaagactgggcctctatgcctggggtgatggctgttgcttcc
ggtggtatccacgtatggcatatgcctgctctcgtggaaatcttcggtgatgactccgtg
ctccaatttggtggtggtactttgggtcacccctggggtaatgctccgggtgcaaccgcc
aaccgtgtcgccttggaagcttgcgttcaagctcgtaacgaaggtcgcagcttggctcgt
gaagggaatgatatcctccgtgaagccggacgttggtctcctgagttggctgtcgctctt
gacctctggaaagaaatcaaatttgagttcgaggcgatggataccgtctga

DBGET integrated database retrieval system