KEGG   Oscillatoria acuminata: Oscil6304_2844
Entry
Oscil6304_2844    CDS       T02368                                 

Definition
(GenBank) cytochrome c-550
  KO
K02720  photosystem II cytochrome c550
Organism
oac  Oscillatoria acuminata
Pathway
oac00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:oac00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    Oscil6304_2844
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:oac00194]
    Oscil6304_2844
Photosynthesis proteins [BR:oac00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in cyanobacteria
    Oscil6304_2844
SSDB
Motif
Pfam: Cytochrom_C550 Cytochrome_CBB3 Cytochrom_C Cytochrom_C1 DUF6268
Other DBs
NCBI-ProteinID: AFY82446
UniProt: K9TJW4
Position
3515693..3516184
AA seq 163 aa
MLKRCIWLAVATVFFTFQIFVGNATAVELDRGIRTVPLNESGQTVVLSLQQVERGKRVFN
DTCSKCHAGGVTKTDFNVSLSQEDLAFATPRRDTIEGLIDYMKNPTSYDGETDISELHPS
IKSADIFAEMRNLTEDDLFAIAGHILIQPKIQGIQWGGGKAYR
NT seq 492 nt   +upstreamnt  +downstreamnt
atgctgaaaagatgcatctggctggctgtagccactgtattcttcacctttcaaatattt
gtcgggaatgccacggcagtggaactcgatcgcgggatccgcaccgtaccattaaacgag
agtgggcaaaccgtcgtcttgagcttgcaacaagttgaacgaggcaaacgggtatttaac
gatacctgctccaaatgccatgccggtggggtgaccaaaaccgacttcaacgtgagtttg
agccaagaagatttggcctttgcaactcctcgacgagatacgattgaagggttaatcgat
tacatgaaaaatccgacgagctatgacggggagacggacatttccgaattacaccccagc
attaagagtgcggatattttcgcggaaatgagaaatctgaccgaggacgatctgttcgcg
atcgccggacacatcctcattcagcctaaaatccaaggcatacaatggggtggtggtaaa
gcctaccgctaa

DBGET integrated database retrieval system