KEGG   Oscillatoria acuminata: Oscil6304_3687Help
Entry
Oscil6304_3687    CDS       T02368                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
oac  Oscillatoria acuminata
Pathway
oac00860  Porphyrin and chlorophyll metabolism
oac01100  Metabolic pathways
oac01110  Biosynthesis of secondary metabolites
oac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Oscil6304_3687
Enzymes [BR:oac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Oscil6304_3687
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Oscil6304_3687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase Baculo_ME53
Motif
Other DBs
NCBI-ProteinID: AFY83248
UniProt: K9TLG1
Position
4667338..4668948
Genome map
AA seq 536 aa AA seqDB search
MTETGGIVYLVGAGPGDAAYLTVRSRQLLAEAEAVVYDALIDEQLLQLAPAGCQRIHVGK
RGGQPSWQQADIDRLLVAQCQQGKRVVRLKSGDPFIFGRCTEEIQALKAARCPYEVIPGI
SSALAGPLLAGIPLTDPVMSHSFTVVTGHDCDRLDWETLTRTPTLVILMGTRQLDEILRQ
LLQHGKSPQTPIAIIRACGTSRQFVWTGTFADIRDRTRGESLSPAVIVIGEVVKLRDYLL
PDSPSRRPLSPDSADSVSMSNYSSHAAKSSPHSASGLGGKTVLVTRSAGQSSTFTEMLTD
VGATVIEMPALEIRPPSSWESLDSAIAQISEFDWLILTSANAVDYFCDRLLAKGKDTRIL
AGVKIAVVGKKTAATLQQRSLTADYIPPDFVADSLVEQFPEDVSGQKILFPRVETGGREV
LVAEFTTQGAIVEEVAAYESGCPDAIAPEAWKALQQRRIDIVTFASSKTVRNFCQLLDRQ
SRSGDQPWHSLLNNVRIASIGPQTSKTCYELLGRVDVEAQEYTLDGLLQALQSGNG
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaaacagggggaattgtctatttggtgggtgcaggtcctggggatgctgcctat
ttaacggtacgatcgcggcaattgttggcagaagcggaggcagtcgtgtatgatgccctg
attgatgagcagttgttgcaattggctcctgccggttgtcagcggatccatgtcggcaaa
cggggtggacaaccgagttggcaacaagcagatatcgatcgcctcttggtggcgcaatgt
cagcaaggcaagcgggtggttcgcctgaaaagtggagacccttttattttcggacgctgt
acggaagaaatccaggcgttgaaggcggcaagatgtccctatgaagtcatccccggcatt
tcttcggcattagcgggaccgttactcgccggaattcccctcactgatccggtgatgagt
cattcgtttaccgtggtgacgggacatgattgcgatcgcctcgactgggaaaccctaacg
cgaacccccactctggtgattttaatggggactcggcaactggatgaaatcctccggcag
ttgctgcaacatggcaaatccccccaaactcccatcgccattattcgcgcttgtggcacc
agtcggcagtttgtttggacggggactttcgctgatatccgcgatcgcacccgaggggaa
tctctctcccctgcggtgattgtgataggcgaagtggtcaaattgcgcgactatctgctt
cccgattccccctctcgtcgtccactctctcccgattctgctgattctgtttccatgtct
aactattcctctcacgctgccaagtcttcccctcattctgcctcgggtttagggggaaaa
accgttctcgtcacgcgatcggcgggacaatcgagtacctttactgaaatgctaaccgat
gttggtgcaacggtaattgaaatgccagcgttggaaattcgtcctccctccagttgggag
tctctggatagtgcgatcgcccaaatttcggagtttgactggttaattctcacctctgcc
aacgccgtggattacttctgcgatcgcctccttgccaagggaaaagatacccgcatcctg
gcgggagttaaaattgcagtggttggcaaaaaaactgctgcaaccttgcaacagcggagt
ttgacagcagattatattcccccagattttgtcgcagattccctggtggaacaatttcct
gaagatgtatcgggacaaaaaatcttgtttcctcgggtggaaaccgggggacgagaagta
ttggtggcagagtttacgactcaaggtgcgattgtggaagaagttgctgcttatgagtcc
ggttgtcctgatgcgatcgcgccggaagcatggaaagcgctgcaacagaggcgcattgat
atcgtcacctttgccagttccaaaaccgtgcgaaacttttgccagttactcgatcgccaa
tcccgcagtggcgatcaaccttggcacagcttattaaataacgtgcgaattgcttcaatt
ggtccgcagacgtcaaaaacctgttatgaattactcggaagagtcgatgtggaagctcag
gaatatactttagacggattgctgcaagccttacagtcggggaacgggtga

DBGET integrated database retrieval system