KEGG   Oscillatoria acuminata: Oscil6304_4442Help
Entry
Oscil6304_4442    CDS       T02368                                 

Definition
(GenBank) PAS domain S-box
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
oac  Oscillatoria acuminata
Pathway
oac02020  Two-component system
oac02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:oac00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Oscil6304_4442
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Oscil6304_4442
Enzymes [BR:oac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Oscil6304_4442
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Oscil6304_4442
Two-component system [BR:oac02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Oscil6304_4442
Bacterial motility proteins [BR:oac02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Oscil6304_4442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR PAS CheR_N PAS_4 PAS_8 PAS_9 PAS_10 APG17 Spc7 WEMBL Fez1 FapA Rootletin Golgin_A5 Sec8_exocyst IncA OmpH Mnd1 HMMR_N EzrA Exonuc_VII_L Tropomyosin Methyltransf_12 CENP-K APG6 HemX UPF0449 HOOK DUF1664 zf-C4H2 Atg14 Fmp27_WPPW DUF3450 TelA DUF812 ATG16 Filament LMBR1 DUF4407 TMF_TATA_bd DASH_Duo1 TMPIT IFT57 Jnk-SapK_ap_N HIP1_clath_bdg CALCOCO1 AAA_11 DUF16 DUF3053 Bap31 DUF4140 Mod_r KxDL Peptidase_S64 V_ATPase_I DUF4201 DUF745 HrpB7 AAA_23 Snapin_Pallidin FAM76 FliJ Prefoldin_3 SesA
Motif
Other DBs
NCBI-ProteinID: AFY83961
UniProt: K9TP75
Position
complement(5704026..5705870)
Genome map
AA seq 614 aa AA seqDB search
MTANDQTSIFEALLEYLRQSRGFDFVGYKRSSLQRRVTKRMQVHQIDNFGDYLEYLKVHP
EEFPALFNTILINVTSFFRDLTAWKYLASHTLPQIIKHKSPEEPLRFWTAGCASGEEAYT
LAILLVETLGIEDCLRRVKIYATDVDEEALTQARNATYKAKDIESISEEFQQRYFRRVGD
RFGLDGDLRRLVIFGRHDLIHDAPISRLDLLICRNTLMYFNAETQKRVLARFHFSLKDTG
FVFLGKAEMLLTHSDLFSPLNLQHRIFQKVRKMDRRDRLLVLAQNRTEEAGRRSTLNIRL
LEAAFNAIPLAQIIVDSDSNLVLANQLARSRFGIDRQDLGRRFQDLEISYRPVELRSQIE
RVYKEGNSILVSDVIRTWSDGSVQYLDIEISPLQQNTSAPLGVSITFNEVTRYHQLQEQL
ERSNQELETVNEELQSSNEELETTNEELQSSHEELETTNEELQSTNEELETMNEELQSSN
EELQTINDDLGQKTIELNQCNVFLESIFASLQSAVIVVDRQFQIQTWNEAAQNLWGPKAD
EVQKQSLFNLDIGLPVERLRDPLYQCLSGTQPGQEILIDALNRQGGSIQCRLSFNPLKDG
SKEPHGVILLIKEV
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaatgatcagacttcaatatttgaagcacttctagagtatctgcgccaatcg
cgcggctttgattttgttggatataagcgctcctccctccagcgtcgagtcaccaagcga
atgcaggtgcatcagattgacaactttggggattacctggaatacttgaaagttcaccca
gaagaattccccgccttattcaacaccatcttaattaacgttactagcttttttcgagat
ctcacggcatggaaatacttagcctcccataccctgccgcagattatcaaacacaaatcc
ccagaagaacccctacgcttctggactgcgggttgtgcctcgggagaagaagcctacacc
ttggcgattttactcgtagaaaccctcggcattgaagactgtctgcgacgggtgaaaatt
tacgccaccgatgtagatgaggaagccttgacacaggcacggaatgccacctataaagcc
aaagatatcgagtctatctcggaggaattccagcagcgatactttaggcgggtcggcgat
cgcttcggattggatggggatctgcgtcggctagtcatctttggtcgtcatgacttgatt
catgatgctcccatttctcgcctggatttgctgatatgccgcaacaccctgatgtatttt
aatgcagaaacccaaaagcgggttctggctcgctttcatttttcactcaaagatacgggc
tttgtatttttgggtaaagccgaaatgctactcactcacagcgatctgtttagtccctta
aacttacagcaccggatctttcagaaagtgcgaaaaatggaccggcgcgatcgcctttta
gtcttagcgcagaatagaacagaagaagccgggaggcgatcgactttaaatatccgcctg
ttggaggccgcttttaatgcgatccctctggcgcaaattatagtagactctgacagcaat
ctcgtcctagccaatcagttagctcggtcccgttttggcattgaccgtcaggacctggga
cgacggttccaggatttagaaatttcttaccgtcccgtggagttgcgatcgcagattgaa
cgggtctacaaagaaggcaactcgattctcgtcagcgatgtgatccgcacttggagcgat
ggcagcgttcagtatttggatatcgaaatctccccgttacagcaaaataccagcgctccc
ctcggcgtgagtatcacgtttaacgaagtcactcgctatcaccagttacaagagcaactg
gaacggtctaaccaggaactcgaaacggtgaatgaggaactccagtccagcaatgaggaa
ctggagacgactaacgaggaactccagtccagccatgaagaactggagacgaccaatgaa
gaactccagtctaccaatgaagaactagagacgatgaatgaggaacttcaatccagcaat
gaggaacttcaaactatcaatgatgacctcgggcaaaaaaccatagaactgaatcaatgt
aatgtttttttagagtctatttttgctagtctgcaatcagcggtgattgtggtagaccgt
caattccaaattcaaacttggaacgaagcggcccaaaatctctggggaccaaaagcggat
gaagtgcagaaacaatctctctttaacctggatattggcttacctgtggaacgtctgcgc
gaccccctttatcaatgcttgagtggcacacaaccgggtcaagaaatcctcatcgatgct
ttgaatcgtcagggtgggtcgattcagtgccgcctgagctttaatccacttaaagatggg
agcaaagaacctcatggggtgattcttttaatcaaggaagtttaa

DBGET integrated database retrieval system