KEGG   Oscillatoria acuminata: Oscil6304_4625Help
Entry
Oscil6304_4625    CDS       T02368                                 

Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
oac  Oscillatoria acuminata
Pathway
oac00230  Purine metabolism
oac00250  Alanine, aspartate and glutamate metabolism
oac01100  Metabolic pathways
Module
oac_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:oac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Oscil6304_4625
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Oscil6304_4625
Enzymes [BR:oac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Oscil6304_4625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AFY84138
UniProt: K9TNZ9
Position
complement(5916783..5918111)
Genome map
AA seq 442 aa AA seqDB search
MANVVVIGAQWGDEGKGKVTDLLSKSADVVVRYQGGVNAGHTVVVKDQTFKLHLIPSGIL
YPETECIIGSGTVIDPKTLIEELDRLEALNISTQNLMISQTAHVTMPYHRLIDQASEERR
GNHKIGTTGRGIGPTYADKSERIGIRILDLIDPEGLRKQLNWTINYKNVILEKLYDLPPL
DPEAVIDEYEQYAQRLRPHVVDASLKIYDAVQEKRNILFEGAQGTLLDLDHGTYPYVTSS
NPVAGGACVGAGVGPTMIDRVIGVAKAYTTRVGEGPFPTEMTEGVGDILCDRGAEFGTTT
GRKRRCGWFDAVIGRYAVRINGIDCLAITKLDVLDELDEIKVCVAYEIDGTRCDNFPSSS
RLFARCKPIYETLPGWQQSTMNCRTLEDLPKQALDYLKYLAELMAAPIAVVSIGASRDQT
IIVEDPIHGPKRGLLDANGTPV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttggctaacgtcgttgtaatcggtgcccagtggggcgatgaaggaaaaggcaaagttacc
gatctgttgagcaagtcggcagatgttgtagtccgttaccaagggggggtcaacgccggt
cacacggtagtagtcaaggaccaaaccttcaaactgcacctgattccctctggtatcctt
tatccagaaaccgaatgtatcattggttcggggacggtaattgatccaaaaactttaatt
gaagaactcgatcgcctcgaagcgctcaatatttctacccagaacctgatgatttcccag
acggctcatgtgacgatgccgtaccatcgcctcatcgatcaggcatcggaggagcgtcgg
ggaaaccacaaaatcggcacaaccgggcgcggaattggcccgacttatgccgataaatcc
gaacggattgggattcgcattttagatttaatcgaccccgaggggctccgcaagcaactc
aactggacgattaactataaaaatgtgattttggaaaaattgtacgatctgccgccgctt
gacccagaggcggtgatcgatgagtacgagcaatacgctcaacgtctgcgtcctcatgtc
gtggatgcctccctgaaaatttatgatgcggttcaagaaaagcgcaatattttatttgaa
ggggcgcaagggactctgctggatcttgatcatgggacttacccttatgtcacctcgtcc
aacccggtagcgggtggagcctgtgtgggagctggagtcggtccgacgatgatcgatcgc
gtcattggtgtggcgaaagcgtacactacccgggtgggtgaagggcctttccccacggaa
atgaccgagggagttggagatatcctgtgcgatcgcggtgcagaattcgggaccaccacg
ggccgaaaacgccgctgtggctggtttgatgccgtcatcggtcgctatgcagtccgcatt
aacggcattgactgtctggcgattaccaaactcgatgttttagacgaactcgacgaaatt
aaagtctgcgttgcctacgaaattgatggcactcgctgcgataatttccccagcagttcc
cgtctgtttgcgcggtgtaaacccatttatgaaacccttcccggttggcagcaatccacc
atgaactgtcggaccttggaagacttacccaagcaagccctagactacctcaaatattta
gccgaattgatggcggccccgatcgccgtggtctccattggggccagtcgtgaccaaacc
atcatcgttgaggaccccatccacggacccaaacgcggtcttttggatgccaacggcact
cccgtctaa

DBGET integrated database retrieval system