KEGG   Oscillatoria acuminata: Oscil6304_4765Help
Entry
Oscil6304_4765    CDS       T02368                                 

Definition
(GenBank) ferredoxin protochlorophyllide reductase subunit B
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
oac  Oscillatoria acuminata
Pathway
oac00860  Porphyrin and chlorophyll metabolism
oac01100  Metabolic pathways
oac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Oscil6304_4765
Enzymes [BR:oac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Oscil6304_4765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red
Motif
Other DBs
NCBI-ProteinID: AFY84276
UniProt: K9TQ68
Position
complement(6077975..6079501)
Genome map
AA seq 508 aa AA seqDB search
MKLAYWMYAGPAHIGTLRVASSFKNVHAIMHAPLGDDYFNVMRSMLERERNYTPVTISVV
DRNVLARGSQEKVIDNIVRKDQEETPDLIVLTPTCTSSILQEDLQNFVDRAQMESKGDVM
LADVNHYRVNELQAADKTLLQILQFYIAKGRKKGDIGEGKTEKPSVNIIGMTTLGFHNQH
DCIELKKLMADLGIEINAILPEGASVTELKNLPRAWFNLVPYREIGLMSAQYLAEEFGMP
YVDITPMGVVETARCIRKIQQVINEQGANVDYEEFINHQTMFVSQAAWFSRSIDCQNLTG
KKAVVFGDNTHAAAMTKVLAREMGIHVVLAGTYCKYDADWFREQVSEYCDEVLISEDNGE
IGDAIARIEPAAIFGTQMERHVGKRLNIPCGVIAAPIHIQNFPIGYKPFLGYEGTNQVTD
LVYNSFTLGMEDHLLEIFGGHDTKEVIQKTISADSDLNWTKEAQGELNKVPGFVRGKVKR
NTEKFARERGFSQISLEVMYAAKESVGA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggcttactggatgtatgcaggtcccgcccacattggcaccctccgcgttgct
agttccttcaaaaatgtccatgccatcatgcacgcccccctcggcgatgactatttcaac
gtgatgcggtctatgctagagcgggagcggaattataccccagtaacgatcagcgttgtc
gatcgcaacgttctcgcccggggttctcaagaaaaagtcatcgataatatcgttcgcaag
gaccaagaagaaaccccagacttgattgtgctcacccccacctgcacctctagcattctt
caagaagatttacaaaactttgtagatcgggcgcagatggagtcaaaaggcgatgtcatg
ctggcggatgtgaaccattatcgggttaatgaactccaagcggcagacaaaactctgcta
caaatcctgcaattctatatcgccaaaggtcgcaaaaaaggcgatatcggtgaaggcaaa
accgaaaaaccttcggtgaatattatcggcatgacgactctgggtttccacaatcagcat
gactgtattgaactgaagaagttaatggcagatttgggcattgaaattaatgccattctt
cccgaaggtgcctcggttactgagttgaaaaacctacctcgggcttggtttaatctggtt
ccttatcgggaaattgggttaatgagcgcccaatatttagcggaagaatttggaatgcct
tatgtggatatcacgccgatgggagtggtggaaacagcccgctgtattcgtaagattcag
caggtgattaatgagcaaggggcaaatgtggattatgaagagtttatcaatcatcaaacc
atgtttgtttcccaagcggcatggttttctcgctctattgactgtcagaatttgacgggt
aaaaaagcggtggtgtttggggataatacccatgccgcagcgatgacgaaggtgctggcg
cgggaaatgggaattcatgtggttttggcggggacttactgcaaatatgatgcagattgg
ttccgggaacaggtgagtgaatattgtgatgaagtgctgattagtgaagataatggggaa
atcggagatgcgatcgcccgcattgaacccgcagccatcttcggtacgcaaatggaacgt
cacgttggcaagcgtttaaatattccttgtggggtgattgccgcaccgattcatatccaa
aacttccccattggatataaaccattcctcgggtatgaaggaaccaatcaagtcacggat
ttggtttataactcgtttactttgggaatggaagaccacctgctggaaatctttggtgga
catgatacgaaagaggtgattcagaaaacgatttctgcggattctgatttgaactggacc
aaagaagcacaaggagaattgaacaaggttcccggttttgtgcgcggtaaggtgaagcgg
aatacggagaaatttgcccgggaacgcgggttcagccagatttctttggaagtgatgtac
gcggcgaaagaatcggtaggcgcgtag

DBGET integrated database retrieval system