KEGG   Oscillatoria acuminata: Oscil6304_4928Help
Entry
Oscil6304_4928    CDS       T02368                                 

Definition
(GenBank) response regulator containing a CheY-like receiver domain and an HD-GYP domain
  KO
K07814  putative two-component system response regulator
Organism
oac  Oscillatoria acuminata
Brite
KEGG Orthology (KO) [BR:oac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:oac02022]
    Oscil6304_4928
Two-component system [BR:oac02022]
 Other families
  Unclassified
   Oscil6304_4928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HD_5 HD TT_ORF2a
Motif
Other DBs
NCBI-ProteinID: AFY84432
UniProt: K9TNL1
Position
complement(6273928..6274989)
Genome map
AA seq 353 aa AA seqDB search
MNFLDAEQSKILVVDDHPASRMTAVALLSVEGYEILEADSGPSALACVKETQPDLILLDV
MMPGMDGFEVCRHLKQDEQTRLIPIIFVTALNDRRSRIRGIEAGGDDFLTKPFDHLELAA
RVKSLVRQKRLNEDLDHAEQVLFSIARTVESRDPNTGDHCERLVSRGQAFGEFLHLSRNE
IRDLMWGGYLHDIGKVGIPDAVLLKTGKLTAQEWEIMKQHVVIGEKICLPLRTMRGVRPL
IRHHHERWDGTGYPDGLVGDEIPYIAQVFQVVDIYDALTSERPYKQAFTSEKALEIIAEE
TAKGWRNPQLVEQFTTFIRTTEMGTPARAVNRLQLIESDEPAAIAGSWRIANG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttccttgatgcagaacagtccaaaattctcgtcgtagacgatcatccagccagc
cggatgacggcagtggcgcttttgtccgtggaagggtatgaaattctggaagcggacagt
ggccctagtgccctggcttgtgtgaaagaaactcagcccgatttaattctgctggacgtg
atgatgcctggaatggatgggtttgaggtgtgccgccatctgaaacaagatgagcaaacc
cgcctgattcccatcatttttgtgaccgcgctcaatgatcggcgatcgcggatccgaggg
attgaagctggaggtgatgacttcctgactaaacccttcgatcatctagaactagccgcc
cgcgtcaaatccctggtccgccaaaaacggctcaatgaggacctcgaccatgccgaacaa
gtcctcttttccattgctcggactgtggaaagtcgcgaccccaataccggggaccactgc
gaacgcttagtctctcgcggacaggcgtttggcgaatttctccatctctcgcgcaatgaa
attcgcgatttaatgtgggggggatacctccatgacatcggcaaagtggggattcctgat
gcggtgttactcaaaacgggtaaacttaccgcccaagagtgggaaattatgaaacagcac
gtggtgattggggagaaaatttgtctacccctgcgaaccatgcgcggcgtccgtcctctg
attcgccatcatcatgaacgatgggatgggacgggatatcccgatgggttggtgggggat
gaaattccctacatcgcccaagtgtttcaagtggtggatatttatgatgccctcaccagc
gaacggccctataaacaagcgtttacttcagaaaaagccctggaaattattgccgaagaa
acagcgaagggatggcgtaacccgcaactggtggaacaatttacgacttttattcggacc
acggagatgggaacaccggcaagggccgtcaatcgcctccaattgattgaatccgacgaa
cccgctgcgatcgccggaagttggcggattgccaatggctag

DBGET integrated database retrieval system