KEGG   Oscillatoria acuminata: Oscil6304_5086Help
Entry
Oscil6304_5086    CDS       T02368                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
oac  Oscillatoria acuminata
Pathway
oac00260  Glycine, serine and threonine metabolism
oac00630  Glyoxylate and dicarboxylate metabolism
oac00670  One carbon pool by folate
oac01100  Metabolic pathways
oac01110  Biosynthesis of secondary metabolites
oac01130  Biosynthesis of antibiotics
oac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Oscil6304_5086
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oscil6304_5086
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Oscil6304_5086
Enzymes [BR:oac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Oscil6304_5086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG POPLD
Motif
Other DBs
NCBI-ProteinID: AFY84588
UniProt: K9TQA0
Position
complement(6483648..6484793)
Genome map
AA seq 381 aa AA seqDB search
MATNAANETAQPLSRTPLYQEAIALKARMTAFSGWEMPVQFSGINPEHQAVRTAAGLFDI
SHMGMFSLCGKDLLTQMQGLVPSDLSRLQPGEGQYTVLLNAKGGILDDIIFYDQGQDEEG
RHFAQVIVNAATCAEDKAWLLAQLAGSDVEFQDLSKQKVLLAVQGPEAVQKLQQFVEVDL
SVVKPFGHLQGSVCGGNGFLARTGYTGEDGYEVMVNPETGITLWRSLVNAGVTPCGLGCR
DTLRLEAAMALYGQDIDVTTTPLEAGLGWLVHLDTKGEFIGREVLVKQKETGVKRRLVGI
EMQGRYIARHGYPVMFEGKPVGEVTSGSWSPTLDHAIALAYLPVELSKPGQSIEVEIRGK
RYPGTVVKKPFYRSVNKPPKS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtggcaactaatgcagcaaatgagacggcacaacccctgtcccgaactcccctctatcag
gaggcgatcgccctcaaagcgaggatgactgccttctctggatgggaaatgccggtgcag
ttttccggcattaatcccgaacatcaagccgtccgaaccgctgcgggactgtttgatatc
tcccacatggggatgttttctctgtgtggtaaagatttactaacgcaaatgcaaggatta
gtcccctcagatttgtctcgcttacaacctggtgagggtcagtacacggttctcctgaat
gccaagggtggcatcttggatgatattattttttatgatcaagggcaggatgaagaggga
aggcattttgctcaggtgattgttaatgccgccacttgtgcagaagataaggcttggtta
ttagcacaattggcagggtccgatgtggaattccaggatttatccaaacaaaaggtatta
ctagcggttcaaggtcctgaagcggtgcagaaactgcaacagtttgtggaggtggatctg
tcggtggtgaaaccctttggacatttacaagggtcggtttgtgggggcaatgggtttttg
gcccgcacgggatacactggggaagatgggtatgaagtgatggtgaatccagaaacaggg
atcacgttgtggcgatcgctggtcaatgctggggtaactccctgtggtttgggttgtcgg
gataccctgcgtctggaagcggcaatggcactttatggtcaagatattgatgtaacaact
acgccgttagaagcgggactgggttggttggtgcatctggacactaaaggggaatttatc
ggcagagaagtgttagttaaacagaaggaaactggggtaaaacggcgcttggtgggaatc
gaaatgcagggccgttatattgctcgtcatggttatccggtgatgtttgaaggtaaacct
gtgggagaggtcaccagtggcagttggtctcctactttggatcatgcgatcgccctggct
tatttacccgtagaactgagcaaacccggtcaatccattgaggtggaaattcgcggcaaa
cggtatcccggaaccgtagtgaaaaagcccttttatcggtcagtaaataaacccccaaag
tcttaa

DBGET integrated database retrieval system