KEGG   Ochrobactrum anthropi OAB: DR92_2905Help
Entry
DR92_2905         CDS       T03251                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
oah  Ochrobactrum anthropi OAB
Pathway
oah00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:oah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DR92_2905
Enzymes [BR:oah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DR92_2905
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DR92_2905
    1.1.1.-  
     DR92_2905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Sacchrp_dh_NADP ApbA DDR_swiveling Shikimate_DH TrkA_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AIK42456
Position
2:complement(292179..293192)
Genome map
AA seq 337 aa AA seqDB search
MKAVRLYAAKDLRVETIDPPSRPKPGWVRLKVSAAGICGSDLHNFMTGQWISRSPSVAGH
EFAGVVTETGAGVTGFKPGDTVIADSRYWCGECQSCKSGRHNVCETLGFIGEVCDGGFAE
ETALPARLLVHYDPAINPVVAAMGEPLSVALHAIRKQRVPSGEAVLVVGCGPIGGLAALL
LSRLHDGPVLVCDRNEQRASLVSTVTGATKVPLDKAAIEAALDGQPIRYAIDATGNIGVL
KAILDVLSGGGSLALVGISHGRIELDPNSLVEREISLIGCHAYQDELREIAKILPDLEAS
LLQLVDREISLDEVPDAYARLIAGEADGLKTIIRTGM
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtccggctttatgcggcgaaggatttgcgggtcgagacaatcgacccgccg
tcgcggcctaagccgggctgggtccggctgaaagtgtcggctgccggtatctgcggctcc
gatctgcataatttcatgaccgggcagtggatcagccggtcaccttcggtcgcaggccat
gaatttgcaggtgtcgtgactgaaaccggtgctggcgtgaccggcttcaaacccggcgat
acggtgatcgcggactcccgctactggtgcggcgaatgccagtcctgcaaaagcggcagg
cacaatgtctgcgaaacgctggggttcatcggtgaagtctgcgatggcggttttgccgag
gagacagcacttcctgcacggctcctcgttcactacgatccggccatcaacccggtggtc
gccgccatgggcgaaccgctttcggtggcgttgcacgccatccgcaagcagcgcgtaccg
tcgggcgaagcggtcctcgttgtgggttgcgggccgatcggcgggcttgcagcacttctt
ctctcccgcctgcatgacggtcctgtactggtctgcgaccgcaacgagcagcgcgccagt
cttgtttcaactgtcaccggcgcaaccaaggttccgctcgacaaggcggcaattgaagcc
gcactcgatggccagcccatccgctatgccattgatgccaccggcaatatcggcgtcctc
aaggcaattctcgacgtgctttccggcggcggttcgctggcacttgtcggcatatcccac
ggcaggatcgaacttgatccgaatagtctggtcgagcgggagatcagcctgatcggctgc
catgcctatcaggacgaactgcgtgaaattgcaaaaatcctgcccgatcttgaggcgtcg
ctgttgcagcttgtcgaccgggaaatttcgctcgatgaggttccggacgcctatgcccgg
ctgattgccggtgaagcggacggcttgaaaacgatcatacggacagggatgtga

DBGET integrated database retrieval system