KEGG   Ochrobactrum anthropi OAB: DR92_360Help
Entry
DR92_360          CDS       T03251                                 

Definition
(GenBank) asp/Glu/Hydantoin racemase family protein
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
oah  Ochrobactrum anthropi OAB
Pathway
oah00471  D-Glutamine and D-glutamate metabolism
oah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DR92_360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:oah01011]
    DR92_360
Enzymes [BR:oah01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     DR92_360
Peptidoglycan biosynthesis and degradation proteins [BR:oah01011]
 Precursor biosynthesis
  Racemase
   DR92_360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AIK44294
Position
1:complement(390663..391499)
Genome map
AA seq 278 aa AA seqDB search
MLKNKTVAAVGDLNDPVAVFDAGIGSYALVELIRRSQPQRDIIYFADRASFPYGAKSRDQ
LLSIMRSTIQYLTSLGAQTIVLASNAPSVMVLDTLKSEFAVPVYGVAPPVRTALAASHSG
KVAVMGVRSMIESEELADFVRTQADNPGDVALINASAMVELVENGAFLRQPDETAQKVAA
FCDDIAASYPLIDTLTLSSTHLPWLRPFFETARPGWQFLDPADDVIAALPQPEGGSGRTV
ALVTKSETYPVAEFRHMLEILQVDLPLTVIDPVFDKPV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaacaagactgtggccgccgtgggagatctcaacgatccggtggccgttttt
gatgcagggatcggcagctatgctctggttgaactgatcaggcgcagccagccgcagcgc
gacatcatctattttgctgatcgggccagtttcccctatggcgccaaaagccgcgatcag
ctgctttccatcatgcgcagcacgatccaatacctcacaagccttggcgctcaaacaatt
gtccttgcttccaatgcgccctcggtcatggtcctcgacacattgaaaagcgagttcgct
gtaccggtttacggcgtagcgccgccggtacgcactgcccttgcggcaagccacagcggc
aaggttgccgttatgggtgtgcgttcgatgatcgagagcgaagaacttgcagattttgtc
cgaacacaggccgataacccaggcgatgtcgctctgatcaatgcgtctgcgatggtggag
ctggtggaaaatggcgcttttcttcggcaaccggacgagaccgcgcaaaaggtcgccgca
ttctgcgatgacattgctgccagctaccctctcatcgacacgctgacactttccagcacc
catctgccatggctcagaccgtttttcgaaacggcccgtcccggctggcagtttcttgat
ccggcggatgacgtgatcgctgcactcccgcaacccgaaggcggctctggtcgcacagtt
gcccttgtcacgaaaagcgaaacctatcccgtcgccgagtttcgccacatgctcgaaata
ttgcaggtcgaccttcctttgacggtcattgaccccgtgttcgacaaacctgtctga

DBGET integrated database retrieval system