KEGG   Ochrobactrum anthropi OAB: DR92_3827Help
Entry
DR92_3827         CDS       T03251                                 

Definition
(GenBank) 3-beta hydroxysteroid dehydrogenase/isomerase family protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
oah  Ochrobactrum anthropi OAB
Pathway
oah00520  Amino sugar and nucleotide sugar metabolism
oah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DR92_3827
Enzymes [BR:oah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     DR92_3827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind NAD_binding_4 3Beta_HSD Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-ProteinID: AIK42664
Position
2:1342614..1343582
Genome map
AA seq 322 aa AA seqDB search
MSTRRILVAGGAGFLGSHLCERLLNEGNFVICVDNFSTGRLENLRNLLRYDTFSFVRHDI
VNPIDLPVDEIYNLACPASPPHYQADPVHTMKTSVIGSLNLLELAAHYQARIFQASTSEV
YGDPQTHPQPEAYWGNVNSFGPRSCYDEGKRSAETLFYDFHKQYGVDIRIVRIFNTYGPR
MRPDDGRVVSNFIVQALEREDITIYGDGSQTRSFCYVDDLIEGFSRLMSSQVQKPVNLGN
PGEFTVRELAEQIIALTNSSSRIVYRPLPTDDPRQRRPDIMLAKRELGWEPQIALVEGLK
QTIAYFERQLVRPSGELFEVAR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacggcgcattcttgtagcaggcggtgccggatttctcggttctcatctttgc
gaacgtcttttgaacgaaggaaacttcgtcatctgcgtcgataatttttcgacagggcgg
cttgagaacctgcgcaatctcctgcgctacgacacgttcagcttcgtgcgtcacgatatt
gtcaacccgatcgatctgccggtggatgagatttacaatctcgcatgccccgcatcgccg
ccacattatcaggccgatccggtgcacacgatgaagacgagcgtcattggctcgctcaat
ctgctcgaacttgccgcgcattatcaggctcggatttttcaggcttcaacgtcggaagtg
tatggcgatccgcaaacacatccgcagccggaagcctattggggcaatgtgaactctttc
ggcccccggtcctgctatgacgaaggcaagcgctcggccgaaacgctgttctacgatttt
cacaagcagtatggcgtcgacatccgtatcgtgcgcatcttcaacacctatggcccgcgc
atgcgacccgacgatggtcgtgtcgtgtcgaacttcatcgttcaggccctcgagcgcgaa
gatatcaccatctatggcgacggctcgcagacccgttccttctgctatgtcgatgacctg
atcgaaggcttcagccgcttgatgagcagtcaggttcagaagcccgtcaatctcggcaat
ccgggcgaattcactgtgcgtgagctggccgagcagatcattgcgctgacaaattcgtcc
tcgcgcatcgtctatcgcccgctgccaactgatgatccgcgccagcggcgcccggacatc
atgctcgccaagcgtgaacttggctgggaaccacagattgcacttgtcgaagggctgaag
cagacgatcgcctattttgaacgccagctggtcagaccatcgggcgagctcttcgaggtg
gcgagatga

DBGET integrated database retrieval system