KEGG   Ochrobactrum anthropi OAB: DR92_573Help
Entry
DR92_573          CDS       T03251                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
oah  Ochrobactrum anthropi OAB
Brite
KEGG Orthology (KO) [BR:oah00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DR92_573
Enzymes [BR:oah01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     DR92_573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AIK43924
UniProt: A0A427JXF0
Position
1:595309..596163
Genome map
AA seq 284 aa AA seqDB search
MSMFRAAAVQMRSGTDVARNIEAMEKLVAEAAVKGAQYVQTPEVTGIMQRDRPLLAQSLR
DEANDPVMAAAAKLASKHGIFLHIGSTLIKGDDGRSYNRGAIFAPSGEKVSTYDKIHMFD
VDLDNGESWRESDACIPGKETVVVDLPFAKFGMAVCYDIRFPQLFRAQALAGANVITGPA
AFTRQTGEAHWHILQRARAIENGAFLISAAQGGLHEDGRETYGHSIIVSPWGKILAEADH
DEPGVILADIDVAESAAARGKIPNLKNAREFDVRTFSAKQKEDA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgttccgcgcagcagccgtccagatgcggtctggcacagacgtggcccgcaat
attgaagccatggaaaaactggtcgcggaagcggcggtcaaaggtgcgcaatatgtgcag
acgccggaagtgaccgggatcatgcagcgtgaccggccattgctcgcacagtcattgcgc
gatgaggccaacgatcctgtcatggctgctgcggcgaagctcgcctcgaaacatggtatc
ttccttcatataggctcgaccctgatcaagggcgatgacggaagatcctataatcgcggc
gcgatctttgcaccgtcgggcgagaaggtctcgacctacgataaaatccatatgttcgat
gtcgatctcgacaatggtgagagctggcgcgaatcggatgcctgtattccgggcaaggaa
actgtcgttgtcgacctgcctttcgcaaagttcggcatggctgtctgttacgacatccgc
tttccgcaattgttccgcgctcaggctctcgccggtgccaatgtgattaccggtccggcc
gccttcacgagacagacaggagaggcccactggcacatcttgcagcgtgcgcgtgctatc
gaaaatggtgcattcctgatctctgccgcacagggcggtctgcatgaggacggccgcgaa
acctacggtcattcgatcatcgtctcaccatggggcaagattctcgccgaagccgatcac
gacgagccgggcgtcatcctggctgatatcgacgtggcggaaagcgctgctgcacgcggc
aagataccgaacctgaagaatgcgcgggagttcgatgtccggactttttccgcgaagcag
aaagaggacgcgtaa

DBGET integrated database retrieval system