KEGG   Oleispira antarctica: OLEAN_C22660Help
Entry
OLEAN_C22660      CDS       T04028                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
oai  Oleispira antarctica
Pathway
oai00480  Glutathione metabolism
oai00590  Arachidonic acid metabolism
oai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    OLEAN_C22660
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    OLEAN_C22660
Enzymes [BR:oai01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     OLEAN_C22660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CCK76442
UniProt: R4YNB7
Position
complement(2482220..2482699)
Genome map
AA seq 159 aa AA seqDB search
MSLLNKKMPLLSGEMQDLSQYQGNVVLIVNTASKCGFTSQYEGLEALYEEYKAQGLVVLG
FPCNQFGEQEKGADSEIASFCQKNYGVSFPMFSKIEVNGDDTAPLYQELKVKAPGVLGTK
KIKWNFTKFLINRQGRVVRYASTTKPEALKSDIEAALAG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcactactaaataagaaaatgccgttattgtcaggagagatgcaggatctttcgcaa
taccaaggcaatgtcgttcttattgttaataccgccagtaaatgtggctttacaagtcaa
tatgaaggtctagaggctttgtatgaagagtataaggcgcaagggctggtggttttaggt
tttccttgtaaccagtttggtgagcaagagaagggtgctgatagtgaaatcgcgagcttt
tgccagaaaaactacggtgttagctttcctatgttctccaaaattgaagtaaacggcgat
gataccgcgccgttgtatcaagagctgaaggttaaggcgccaggtgttttgggaacaaag
aagattaagtggaacttcactaaatttttgattaacaggcagggtcgtgttgtgcgctat
gcctcaacgactaagcctgaagcattgaaatctgatattgaagcggcattggcaggttaa

DBGET integrated database retrieval system