KEGG   Oleispira antarctica: OLEAN_C25530Help
Entry
OLEAN_C25530      CDS       T04028                                 

Definition
(GenBank) Phosphate family transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
oai  Oleispira antarctica
Brite
KEGG Orthology (KO) [BR:oai00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    OLEAN_C25530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Lig_chan
Motif
Other DBs
NCBI-ProteinID: CCK76729
UniProt: R4YUJ2
Position
2848061..2849326
Genome map
AA seq 421 aa AA seqDB search
MELLAEHGHIFIALACIFGLFMAWGIGANDVANAMGTSVGSKAITIKQAILIAIVFEFAG
AFLAGGEVTATIRKGIIDPSALADSPELLVFGMLASLLAAGIWLLVASIKGWPVSTTHSI
VGAIVGFSAVGIGVEAVAWGKVGTIAASWIISPMLAGSIAFVLYKTVQHWIHDTENPFAQ
SKKVVPFYIFLVGFIISMVTLTKGLKHIGLDISFQQSIWMSLIAGVVITFIGIFFVNRVH
ADPESNEEEHLANVEKVFAVLMVFTACAMAFAHGSNDVANAIGPVAAIYSVVSSSGEIAA
KAAVPAWILLIGGLGIVVGLVTYGHKVIATVGTGITQLTPSRGFAATLAAATTVVVASGT
GLPISTTHTLVGAILGVGLAVGRESLNYRQIGAIFMSWLVTLPAGAALSIFFFFIFRAIW
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggaacttctagccgaacacgggcatatttttatcgccctagcatgtatttttggtctt
ttcatggcatggggtattggtgctaatgatgttgctaatgcaatggggacctccgtaggt
tctaaagcaatcaccatcaaacaagctattttaattgctattgtgtttgaatttgcgggt
gcgtttctcgccggtggtgaagtaacggccactattcgaaaaggcatcattgatccttct
gcactggcagactctcccgaattgctcgtttttggtatgctggcgtctttattagcagca
gggatttggttattggttgcgtcgattaaaggctggcctgtttcaaccacccactctatc
gttggcgccattgttggtttttctgccgtcggcatcggcgtagaagcggttgcttggggt
aaggtaggcacaattgccgctagctggattatttcaccgatgctcgcgggtagtattgct
tttgtcttgtacaaaacggtacagcactggattcatgatactgaaaatccttttgctcaa
tctaagaaagtcgttcctttctacatatttctggtcggcttcatcatctctatggtcaca
ttgaccaagggtttgaaacacattggcctcgacattagttttcaacagtcaatttggatg
tcgctcatcgcaggggttgttatcacctttatcggtatattctttgttaatcgtgtccac
gcagaccctgaaagcaatgaagaagaacacctcgccaacgttgagaaagtatttgctgta
ttaatggtattcaccgcttgcgccatggcttttgcccacggctctaacgatgtcgctaac
gccattggccctgttgccgctatttacagcgttgtaagcagctcaggtgaaatcgctgcg
aaagccgctgttcctgcttggatcttgttgattggtggcctgggtatcgtagttggctta
gtcacttatggtcataaagtaattgcaaccgtcggcaccggtatcactcagttaacacca
agccgtggctttgctgccaccctagcggcagcaacaaccgtcgttgttgcatcgggtact
ggcttaccgatttcgacgactcatacgctcgtaggcgctatcttaggcgtaggtcttgcg
gtaggtcgtgaatcattgaactatcgtcaaatcggcgccattttcatgtcttggctagtc
actctgccagcaggtgcagcactttctatcttcttcttctttatcttcagagcaatctgg
ggataa

DBGET integrated database retrieval system