KEGG   Oleispira antarctica: OLEAN_C32530Help
Entry
OLEAN_C32530      CDS       T04028                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oai  Oleispira antarctica
Pathway
oai00071  Fatty acid degradation
oai00280  Valine, leucine and isoleucine degradation
oai00310  Lysine degradation
oai00362  Benzoate degradation
oai00380  Tryptophan metabolism
oai00620  Pyruvate metabolism
oai00630  Glyoxylate and dicarboxylate metabolism
oai00640  Propanoate metabolism
oai00650  Butanoate metabolism
oai00900  Terpenoid backbone biosynthesis
oai01100  Metabolic pathways
oai01110  Biosynthesis of secondary metabolites
oai01120  Microbial metabolism in diverse environments
oai01130  Biosynthesis of antibiotics
oai01200  Carbon metabolism
oai01212  Fatty acid metabolism
oai02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OLEAN_C32530
   00630 Glyoxylate and dicarboxylate metabolism
    OLEAN_C32530
   00640 Propanoate metabolism
    OLEAN_C32530
   00650 Butanoate metabolism
    OLEAN_C32530
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OLEAN_C32530
   00072 Synthesis and degradation of ketone bodies
    OLEAN_C32530
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OLEAN_C32530
   00310 Lysine degradation
    OLEAN_C32530
   00380 Tryptophan metabolism
    OLEAN_C32530
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OLEAN_C32530
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OLEAN_C32530
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OLEAN_C32530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oai04147]
    OLEAN_C32530
Enzymes [BR:oai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OLEAN_C32530
Exosome [BR:oai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OLEAN_C32530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CCK77429
UniProt: R4YV19
Position
3681127..3682335
Genome map
AA seq 402 aa AA seqDB search
MTAEAYIFDAIRTPRGRGKASGALHEVKPITLLSDLLISLQERNQFDTAAVDDIVMGCVT
AVGDQGAVIAKTAALAAGWNEDVAGVVLNRFCASGLEAVNIAAMKVRSGWEHLVVAGGVE
SMSRVPMGSDGGAWAMDPETNVATGFMPQGIGADLIGTLGGYSREDVDAFAMRSHHKAAA
AWKKNAFQKSIIPVTDRNGLILLEHDELIRAESSVETLGKLKPSFKMMGDMGFDNVAKER
YPQVEFINHIHSPGNSSGIVDGAAVVLIGSAAAGKQFNMTPRARIVATAVVGAEPTIMLT
GPAPAARKALKVAGMDVSDIDLFEVNEAFASVVMRFIDEMGISEDIVNVNGGSIAMGHPL
GATGAMILGTLLDELEARDLKTGLVTLCVGGGMGIATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacagctgaagcttatatttttgatgcgattcgtactccacgcgggcgtggtaaagcg
agtggtgctttgcacgaagttaaaccgattactctgctcagcgatttattgattagtctg
caagagcgtaatcaatttgatactgcagcagtcgatgacattgtcatgggctgcgtgacc
gctgtcggtgaccaaggcgcggtgattgccaaaacggccgctttggctgctggctggaat
gaggacgtagcaggtgttgtgctgaatcgtttttgcgcatcaggattagaagccgtgaat
attgcggcgatgaaagtacgttctggctgggaacacttggttgtcgctggcggtgttgaa
tcgatgtctcgagtgccaatgggcagcgatggtggcgcgtgggcgatggacccagaaacc
aatgttgccacgggttttatgccacaagggattggcgcagatttgattggtaccttgggc
ggttactcgcgtgaagatgtggatgcttttgctatgcgttcgcaccataaagccgcagcc
gcttggaaaaagaacgccttccaaaaatcgattattccagttacagatcgcaacggcctt
atcttacttgagcatgatgaattaattcgtgctgaaagctcagtagagacattgggtaaa
cttaagccctcttttaagatgatgggcgacatgggttttgataacgtggcgaaagaacgt
tatccacaggttgagtttattaatcatattcatagcccgggtaattcatcgggcattgtt
gatggtgcagcggtggtattgattggcagcgccgcagcaggcaagcaatttaatatgact
cctcgtgcccgtattgtagcgaccgcggttgttggcgctgaaccgaccatcatgttaacc
ggccccgctccggcagcgcgtaaagcgttaaaagtggcgggcatggatgtttctgatatt
gatttgtttgaagtgaatgaagcctttgcttctgtcgtgatgcgctttattgatgagatg
ggaatcagtgaagatattgttaacgtcaatggtggttctattgcgatgggtcatccatta
ggtgcaacgggtgcgatgattttaggcaccttgttagatgagctagaagcgagagatttg
aagacgggtctagtgaccttgtgtgtcggtggcggcatgggcatcgcaacgattattgaa
cgcgtttaa

DBGET integrated database retrieval system