KEGG   Oleispira antarctica: OLEAN_C35680Help
Entry
OLEAN_C35680      CDS       T04028                                 

Gene name
purA
Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
oai  Oleispira antarctica
Pathway
oai00230  Purine metabolism
oai00250  Alanine, aspartate and glutamate metabolism
oai01100  Metabolic pathways
Module
oai_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:oai00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    OLEAN_C35680 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OLEAN_C35680 (purA)
Enzymes [BR:oai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     OLEAN_C35680 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: CCK77744
UniProt: R4YV82
Position
complement(4016403..4017695)
Genome map
AA seq 430 aa AA seqDB search
MGKNVVVLGTQWGDEGKGKIVDLLTEKATAVVRFQGGHNAGHTLVIDGVKTALHLIPSGI
LREGVQCIIGNGVVVAPDALLKEARALEARGVPVMERLRISHACPLILPYHVALDQAREI
KRGNAKIGTTGRGIGPAYEDKVARRGLRIGDMYQPEFAAKLKDVMEFHNFSLVNYYGVEA
IDYEETLALCIDWAEQIKAVVVDAVDLVHTIREAGGDIMFEGAQGTLLDIDHGTYPFVTS
SNTTAGGVACGSGVGPLYLDQIMGITKAYTTRVGEGPFPTELFDDVGEHLSTVGQEKGTT
TGRSRRCGWFDAALVKHAIRVNSVNAICLTKLDVLDGLETVKICVGYQDADGNRMNVPAS
ADQFAKITPVYEELPGWTESTVGAQTLDQLPENAKAYIRFIEEAIGAPIDIISTGPDRIQ
TIVLRHSFAI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaacgttgtcgttttaggcacccaatggggtgatgaaggtaaaggtaaaatt
gttgatctactaacggagaaagcaactgcggttgttcgcttccaaggtggtcacaatgca
ggacacacattggtcatcgacggtgttaagaccgcattgcacttgattccttcgggcatc
ttgcgtgaaggcgttcagtgcattattggtaacggtgttgttgttgctcctgacgcttta
ctaaaagaagctcgtgcattagaagcgcgtggtgttccagtcatggaacgtctacgaatt
tctcacgcctgtcctttgatcttgccttatcacgttgctttagaccaagcccgtgaaatt
aaacgtggcaacgctaaaattggaacgactggccgtggtattggtccagcgtacgaagat
aaagtagctcgtcgtggtttgcgtattggtgatatgtatcagccagaattcgcggctaaa
ttaaaagatgttatggaattccataatttctctttggttaactactacggcgttgaagcg
attgattacgaagaaacgttagcgttatgtatcgattgggctgaacagattaaagcggtt
gttgttgatgcggttgatctggtgcatacgattcgtgaagcgggcggcgacatcatgttt
gaaggcgctcaaggcaccttgcttgatatcgaccacggtacttacccgtttgtaacgtct
tctaataccaccgctggcggtgttgcttgtggttctggtgtaggtcctttgtaccttgat
cagatcatgggtattaccaaagcgtatacaactcgtgtgggtgaaggtcctttcccaaca
gaattgttcgatgacgtcggtgagcatttatcaacagtaggccaagagaaaggcactaca
acaggacgttcgcgtcgctgtggttggttcgatgcggcattagttaagcatgcgatccgt
gttaactcagtaaatgctatttgtctaacaaagctagacgttcttgatggcctagaaaca
gttaaaatatgtgttggttaccaagacgctgatggcaaccgtatgaacgttcctgcaagc
gcagatcagttcgcaaagatcactcctgtgtatgaagaattaccaggttggacggaaagc
actgtaggcgcacaaactttggatcagcttccagagaatgctaaagcttacattcgcttt
atcgaagaagcgattggcgcacctatcgatattatttcgacgggtcctgaccgcattcaa
acgattgtattgcgccacagctttgcgatataa

DBGET integrated database retrieval system