KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0678
Entry
Oant_0678         CDS       T00568                                 

Definition
(GenBank) P-type DNA transfer protein VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:oan00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Oant_0678
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oan02044]
    Oant_0678
Secretion system [BR:oan02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Oant_0678
SSDB
Motif
Pfam: T4SS Cep57_CLD_2 PDEase_I NPV_P10
Other DBs
NCBI-ProteinID: ABS13403
UniProt: A6WWP9
Position
1:705993..706691
AA seq 232 aa
MASYRCSCAIMAAVLTLSTGAAMGQGIPVIDQTAIAKHMESIAQLKSQLDALHQQIEKAE
ELYTSFNKLTDMADVAKVLNDPAIRKALPPEFAAVEGLFEGNGSGALNDAATKFLDKNTT
YKTSADDFYAKELSRVQNKNAGQMGIGQKIYDTATKRIEGIDELRQKISTASEAKEIADL
QARLLAEQAFVQTDVLRMEGLRMVQQAQTQVDDQRKAEDWRRRMDAMKGALK
NT seq 699 nt   +upstreamnt  +downstreamnt
atggcttcttatagatgttcttgcgcaatcatggctgcagtgctgaccttgtcgacagga
gctgcgatggggcagggcatccctgtcattgatcaaacagcgatcgccaaacatatggaa
agtatcgcgcagttgaaatcgcagctcgatgctcttcatcagcagattgagaaggccgaa
gagctttatacctctttcaacaagctgacagatatggcggatgtcgcaaaggttctcaat
gatccagcgatccgaaaagcccttccgccggaatttgctgccgtagaaggattatttgaa
ggcaatggcagtggggcgttgaacgatgctgcaacaaaattcctcgacaaaaatacgacc
tacaaaacttccgctgacgatttttacgcaaaagaactgtcccgtgtgcagaacaaaaat
gccggccagatggggatcggccagaaaatttacgacacagcaacaaaacgcatcgaagga
attgatgaactacgtcagaaaatttccacggcaagtgaagccaaggaaattgccgatttg
caagcaaggcttctggccgagcaagcctttgtgcaaaccgatgtgctgcgcatggaaggc
ttgcgcatggttcagcaggcgcaaacgcaggttgatgatcagcgcaaggcagaagattgg
cgccgtcgcatggatgcaatgaagggggcgctgaaatga

DBGET integrated database retrieval system