KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0715Help
Entry
Oant_0715         CDS       T00568                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00071  Fatty acid degradation
oan00280  Valine, leucine and isoleucine degradation
oan00281  Geraniol degradation
oan00310  Lysine degradation
oan00360  Phenylalanine metabolism
oan00362  Benzoate degradation
oan00380  Tryptophan metabolism
oan00410  beta-Alanine metabolism
oan00627  Aminobenzoate degradation
oan00640  Propanoate metabolism
oan00650  Butanoate metabolism
oan00903  Limonene and pinene degradation
oan00930  Caprolactam degradation
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01120  Microbial metabolism in diverse environments
oan01130  Biosynthesis of antibiotics
oan01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Oant_0715
   00650 Butanoate metabolism
    Oant_0715
  Lipid metabolism
   00071 Fatty acid degradation
    Oant_0715
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Oant_0715
   00310 Lysine degradation
    Oant_0715
   00360 Phenylalanine metabolism
    Oant_0715
   00380 Tryptophan metabolism
    Oant_0715
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Oant_0715
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Oant_0715
   00281 Geraniol degradation
    Oant_0715
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Oant_0715
   00627 Aminobenzoate degradation
    Oant_0715
   00930 Caprolactam degradation
    Oant_0715
Enzymes [BR:oan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Oant_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABS13437
UniProt: A6WWT3
Position
1:complement(743978..744751)
Genome map
AA seq 257 aa AA seqDB search
MAYETIIVETRGGVGLIRLNRPQALNALNRKVLDELTEALGAFDTDGKIGAIVLTGSEKA
FAAGADIKEMQPIDFVDAYLQDMFADWQKVDRVRKPIIAAVSGYALGGGCELAMMCDFII
AGSNAKFGQPEITLGVMPGMGGSQRLTRYVGKSKAMDMCLTGRMMDAAEAERSGLVSRVV
APEELLDEALKAAERIASFSRPSVLMVKEAVNRTYEMTLSEGLRFERRQFHSLFATEDQK
EGMAAFIDKRTPSFKNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgaaacgatcatcgtcgagacacgtggcggcgttggcctcatccgcctcaac
cgcccgcaggcgctcaatgccttgaaccgcaaggttctcgacgaattgacggaagctctc
ggcgctttcgatacggacggcaagatcggcgctatcgtcctcaccggttccgaaaaggcc
ttcgctgccggtgccgacatcaaggaaatgcagccgatcgatttcgtggatgcctatctt
caggacatgtttgctgactggcagaaagtggatcgggtccgcaagccgatcatcgcggcg
gtttcgggctatgcgctgggcggcggctgcgaactcgccatgatgtgcgatttcatcatc
gcgggcagcaacgcaaaattcggccagccggaaatcacgctcggcgtcatgcccggcatg
ggcggctcgcagcgtctcacgcgctatgtcggcaagtccaaggcgatggatatgtgcctc
accgggcgcatgatggatgcggcggaagcagaacgcagcggtctcgtctcgcgcgtcgtt
gcgccggaagagcttcttgacgaagcgctgaaggcggcagaacgcattgcatccttctca
cgtccgtctgtgctgatggtcaaggaagcggtcaatcgtacctacgaaatgacgctgagc
gaaggactccgcttcgagcggcgccagttccattcgctgtttgcgacggaagaccagaag
gaaggcatggcagccttcatcgacaagcgtacgccgtcgttcaagaatcgctaa

DBGET integrated database retrieval system