KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0931Help
Entry
Oant_0931         CDS       T00568                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00020  Citrate cycle (TCA cycle)
oan00640  Propanoate metabolism
oan00660  C5-Branched dibasic acid metabolism
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01120  Microbial metabolism in diverse environments
oan01130  Biosynthesis of antibiotics
oan01200  Carbon metabolism
Module
oan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Oant_0931
   00640 Propanoate metabolism
    Oant_0931
   00660 C5-Branched dibasic acid metabolism
    Oant_0931
Enzymes [BR:oan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Oant_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABS13652
UniProt: A6WXE8
Position
1:967429..968625
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTLPGPLYVVKSQIHAGGRGKGKFK
ELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGPAGKQVNRLYIEDGADIDRELYL
SILIDRTVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDASKLADALKLE
GQAREDGVKLFPILYKAFTEKDMSLLEINPLIVMTDGRVRVLDAKVSFDGNALFRHPDIQ
ELRDLSEEDEKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITADPAVQGILVNIFGGIMKCDVIAEGVIAAVKEVGLKVPLVVRLE
GTNVELGKKIINESGLNVISADDLDDAAQKIVAAVKGN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaataccaggccaagcgcctgcttcacacctacggcgcaccgatcgcc
aatggtgtggctgtctattccgtcgaacaggcggaagaatgggcaaagacgcttcccgga
ccgctttatgtcgtcaagagccagatccatgctggtggacgcggcaagggcaagttcaag
gaactgccagccgatgcaaagggcggcgtgcgcctcgccaagtcggttgaggaagtggtt
gccaatgcgaaggaaatgctcggcaacacgcttgtcaccaagcagaccggccctgccggc
aagcaggtcaaccgtctttacatcgaagacggcgccgacatcgatcgcgagctttatctc
tcgatcctgatcgaccgcaccgttggtcgtccggcttttgtcgtttcgaccgaaggcggc
atggacatcgaagccgttgccgaagaaacccctgaaaagatcgtgactgtcgccatcgat
ccggccaagggcgtaacggacgaagacgccagcaagctcgccgacgcgctgaagcttgaa
ggtcaggctcgtgaagacggcgtcaagctgttcccgatcctctacaaggcgttcaccgaa
aaggacatgagccttctcgagatcaacccgctgatcgtcatgaccgatggccgcgtgcgc
gttctcgacgccaaggtatcgttcgacggcaatgcgctgttccgtcatcctgacattcag
gaactgcgcgatctgtcggaagaagacgaaaaagagatcgaagcttccaagtacgatctc
gcttacgtcgctctcgacggcaatatcggctgcatggtcaacggcgcaggccttgccatg
gcgacgatggacatcatcaagctctacggtgcagaacctgccaacttcctcgacgttggt
ggcggcgcttccaaggagaaggtgacggctgcgttcaagatcatcaccgctgatccggct
gtccagggcattctggtcaacatcttcggtggcatcatgaagtgcgacgtcattgccgaa
ggcgtgatcgccgcggtcaaggaagtcggcctcaaggttcctctggttgtccgtctcgaa
ggcaccaatgtcgaactcggcaagaagatcatcaacgagagcggcctgaacgtcatttcg
gccgacgatctcgacgatgcggcgcagaagatcgtcgctgcagtgaaggggaattaa

DBGET integrated database retrieval system