KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0935
Entry
Oant_0935         CDS       T00568                                 

Definition
(GenBank) conserved hypothetical protein
Organism
oan  Ochrobactrum anthropi ATCC 49188
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-ProteinID: ABS13656
UniProt: A6WXF2
Position
1:974105..974518
AA seq 137 aa
MEPGVFSASPFLPLVGLSVVLLVVHILLQGFAATKELGSRWNAGPRDEGLKPSGKFAGRA
ERASANFRETYPAFIGLALALVLKGDPSGWGIVGAWLWFFGRIVYIPLYLAGIPYFRSFV
WLISLVGLGIMLLALVL
NT seq 414 nt   +upstreamnt  +downstreamnt
atggagccgggcgtcttctccgcatctccgtttctgccgttggtcggcttgagcgttgtc
ctgctggtggttcatatcctcctgcagggctttgcggcgacgaaggaactcggctctcga
tggaatgccggtccgcgcgacgagggtttgaaaccctccggtaaatttgccgggcgcgcg
gagcgggcctctgccaatttccgtgagacctatccggctttcatcggtctggcgctggcg
ctcgtgctgaaaggcgatccgtccggatgggggattgtcggcgcgtggctctggtttttc
ggccgcatcgtctatatcccgctttatcttgcgggcattccctatttccgttccttcgtc
tggctcattagtctggtggggctcggtatcatgcttctggctttggttctgtga

DBGET integrated database retrieval system