KEGG   Ochrobactrum anthropi ATCC 49188: Oant_1418
Entry
Oant_1418         CDS       T00568                                 

Definition
(GenBank) periplasmic binding protein/LacI transcriptional regulator
  KO
K23508  galactofuranose transport system substrate-binding protein
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:oan00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Oant_1418
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oan02000]
    Oant_1418
Transporters [BR:oan02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    Oant_1418
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 ABC_sub_bind Peripla_BP_6 PucR
Other DBs
NCBI-ProteinID: ABS14135
UniProt: A6WYT1
Position
1:complement(1500010..1500969)
AA seq 319 aa
MKRTLTALTAAFSFALISSASAASLTVGFSQIGSESGWRAAETALTKQEAEKRGYTLKFA
DAQQKQENQIKAVRGFIAQGVDAILIAPVVSTGWDAVLKEAKEAEIPVVLLDRQIDSPED
LYLTAVTSDQVHEGKVAGDWLVKDVGDKPCNVVELQGTTGSSPAINRKKGFEDAIEGHDN
IKISRSQTGDFTRTKGKEVMESFIKAEGGGKNICAVYAHNDDMAVGAIQAIKEAGLKPGT
EIKIVSIDSVPDIFQAMANGEANATVELTPNMAGPAFDAIEAFKDKGTVPPKWIQTESKL
YTQADDPKAVYEAKKGLGY
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaaacgcacattgacggccctgacggccgcattttcttttgccctgatttcgagcgca
tctgctgcatcgctgacggttggcttttcgcagatcggttcggaatcgggctggcgtgct
gcagaaacggccctgaccaagcaggaagccgaaaaacgcggctatacgctcaagttcgcc
gatgcacagcaaaagcaggaaaaccagatcaaggccgttcgtggcttcatcgctcaaggg
gttgatgcaatcctgatcgcaccggtggtctccacaggttgggacgccgttctgaaggaa
gccaaggaagccgaaattccggtcgtcctgctcgaccgccagatcgattctccggaagac
ctttatctgaccgccgtaacctccgatcaggttcatgaaggcaaggtggccggtgactgg
ctggtgaaggatgtgggcgacaagccgtgcaatgtggtcgagcttcagggcaccaccggt
tcctcgcccgccatcaaccgcaagaagggttttgaagacgccatcgagggtcatgacaac
atcaagatttcccgctcgcagacgggtgacttcacccgcacaaagggcaaggaagtcatg
gaaagcttcatcaaggccgaaggcggcggcaagaatatctgcgccgtctatgcccataat
gacgacatggctgtcggcgccattcaggcaatcaaggaagctggcttgaagccgggcacg
gaaatcaagatcgtgtcgatcgactccgtgccggacatcttccaggccatggcgaacggc
gaagccaacgcgaccgtcgaactgacgccgaacatggcaggcccggccttcgacgcgatt
gaagccttcaaggacaagggcaccgttccgccgaagtggatccagacggagtcgaagctc
tacacgcaggctgacgacccgaaggccgtctatgaagccaagaagggtctcggctactga

DBGET integrated database retrieval system