KEGG   Ochrobactrum anthropi ATCC 49188: Oant_1872Help
Entry
Oant_1872         CDS       T00568                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00860  Porphyrin and chlorophyll metabolism
oan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Oant_1872
Enzymes [BR:oan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Oant_1872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase_5 BPL_N
Motif
Other DBs
NCBI-ProteinID: ABS14588
UniProt: A6X034
Position
1:1973835..1975286
Genome map
AA seq 483 aa AA seqDB search
MARAIMFQGTGSDVGKSVLVAGLCRVARNRGLNVRPFKPQNMSNNAAVSDDGGEIGRAQW
LQALACGVPSSVHMNPVLLKPQTDMGSQVIVQGQVRGEARGRYYQELKPQLMAAVMESFA
RVSEGADLVLVEGAGSPAEINLRAGDIANMGFATQADVPVVLVGDIDRGGVIASLVGTHT
ILSEQDRAMVRGFLINKFRGDISLFDDGLAAITRFTGWRSFGVVPWLKAVSRLPAEDSVV
LERAVRGDKKSLVVAVPMLPRIANFDDLDPLKAEPDVEVVMVPPGSSIPGDAGLVVLPGT
KSTIADMQAVRDNGWDRQLSAHVKRGGHVLGICGGFQMLGHHISDPAGIEGHVRDIDGLG
LLDIETVMEPEKVVRNVQATALLHNVPLEGYEIHIGRTTGPDMGWPFARIGEHDDGAISP
DGRIMGTYLHGVFNADEFRRRFLQNLGVQSSSVNYRAGVEAALDELAEGLEACLDIDALF
NLK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgcaatcatgtttcagggaacgggttcggacgtcggcaaaagtgttcttgtt
gccggactatgccgggttgcgcgcaatcgcggcctgaatgttcgaccgtttaagccgcaa
aacatgtccaacaatgcggcagtcagcgacgatggtggcgaaattggtcgggcgcagtgg
ttgcaggcgctggcttgcggtgtgccgtcgtctgtccatatgaatccggtactcctcaaa
ccgcagactgacatgggtagtcaggttatcgtccagggacaagtgcgaggcgaggcgcgc
gggcgctattatcaggaattgaaaccgcagctcatggcggctgtcatggaatccttcgcc
agggtcagcgaaggcgcggaccttgtgctggtggaaggggcggggtcaccagctgaaatc
aatctgcgggccggtgatatcgccaatatggggtttgccacacaggccgatgtcccggtt
gttctggtcggtgacatagacagaggtggcgtgattgcgtctctcgtcggcacgcacaca
attctgtccgaacaggaccgcgccatggttcgcggatttctgatcaacaagttccggggc
gatatttcgctttttgatgacgggctggctgccattacccggtttaccggctggcgttct
ttcggcgttgtcccgtggctgaaagcggtatcgagactgccagccgaagattctgtcgtt
cttgaacgtgccgttcgcggagacaagaagtcgctcgtggttgctgtgccgatgttgccg
cgcattgccaacttcgatgatcttgatccgctaaaggctgaaccggatgtagaagtggtc
atggtgccgcctggttcgagcattcccggcgatgcgggccttgtcgttctgccggggaca
aagtccacgatagccgatatgcaggcggttcgggacaatggctgggatcgccaattatct
gcccacgtgaaacgaggcggtcatgtgcttggtatctgcggcgggttccagatgcttggt
caccacatcagcgaccctgctggtatcgaggggcatgtacgcgacattgatggtcttggg
ctgctcgatatcgaaacggtgatggaacctgaaaaagtggtccgcaacgtgcaggcgacc
gcgcttctccataatgtgccgctggagggctatgaaatccatatcggccgcacgactgga
ccggatatggggtggcctttcgctcgaattggcgagcatgacgacggagccatatcacca
gatgggcgcatcatggggacctatctccacggtgttttcaatgcggatgaatttcgccgg
agatttctgcagaatcttggtgtgcagagcagttcagtgaactatcgcgccggcgttgaa
gctgcattggatgaactggccgaagggctggaagcatgtctcgatatcgatgcactgttt
aatttgaaatga

DBGET integrated database retrieval system