KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2079Help
Entry
Oant_2079         CDS       T00568                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00450  Selenocompound metabolism
oan00970  Aminoacyl-tRNA biosynthesis
oan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Oant_2079
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Oant_2079
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:oan01007]
    Oant_2079
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oan03016]
    Oant_2079
Enzymes [BR:oan01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Oant_2079
Amino acid related enzymes [BR:oan01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Oant_2079
Transfer RNA biogenesis [BR:oan03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Oant_2079
 Prokaryotic type
   Other AARSs
    Oant_2079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF1614
Motif
Other DBs
NCBI-ProteinID: ABS14795
UniProt: A6X0P1
Position
1:2174858..2176405
Genome map
AA seq 515 aa AA seqDB search
MSREKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGKDVFFLTGTDEHGIKMLQS
ARKEGITPRELADRNTAAFRQMADVLNSSNDDYIRTSEERHYKASQAIWKAMAGNGDIYK
GGYAGWYSVRDEAYYGEEETEVREDGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYE
KNPGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITA
LGYPDTSDEKWGYWPADAHIIGKDISRFHAVYWPAFLMSAGIPLPKRVFAHGFLFNRGEK
MSKSLGNVIDPFGLVERYGLDQLRYFLMREVPFGQDGSYSHDAIVNRTNADLANDLGNLA
QRSLSMIAKNCEGKVPVPGEFSDADKAILDQADAALETARKAMDDQALHLALGAIFAVVA
EANRYFAGQEPWALRKTDPARMGTVLYVTAEVIRRVGIMVQPFIPQSAEKLLDILAIPAD
KRQFSDVTASQLVGGADLPAPQPVFPRYVETEEQN
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgaaaaatattacatcaccaccgcgattgcttatccgaacggaaagccgcac
atcggccacgcgtatgagttgatcgcgaccgatgcaatggcgcgttttcagcgcctgaac
ggcaaggatgttttctttctgaccggtacggacgaacacggcatcaagatgttgcagagc
gcgcgcaaggaaggcattacgccgcgcgagctcgcagatcgcaatacggctgcgttccgc
cagatggcggatgtgctgaacagctcgaatgacgactatattcgcacctcggaagagcgc
cattacaaggcgagtcaggctatctggaaagcgatggctggcaatggcgatatctacaag
ggtggatatgccggctggtattccgtgcgtgacgaagcctattacggcgaagaggaaacg
gaagtccgcgaggatggtgtgcgctacggtccgcaagggactcctgtcgaatgggttgag
gaagaaagctatttcttccgtctctcagcctatcaggacaaattgctcgatctttacgag
aagaatccgggcttcatcatgcctgcggagcgccgcaacgagattgtgagcttcgtcaag
tcgggtctgaaggacctgtcgatttcgcgtacgacattcgattggggcattccggtgccg
ggtgacgagaaacacgtcatgtatgtctgggtcgatgccctgaccaattacattactgct
cttggctatcctgatacttcggatgaaaagtggggttattggcctgccgatgcacatatc
atcggcaaggatatctcgcgctttcacgccgtctattggcccgcattcctgatgtcggct
ggtattccgctgccgaagcgggttttcgcacatggcttcctgttcaaccgtggcgagaaa
atgtcgaagtccctcggcaatgtgatcgatcccttcggtctcgttgaacgttatgggctc
gatcagctgcgctatttcctgatgcgtgaagtaccattcggtcaggatggcagctacagt
catgacgccatcgtcaaccgcaccaatgccgatctggccaatgatctcggtaatctggcg
cagcgttcgctgtcgatgatcgccaagaattgcgaaggtaaggttccggttccgggtgaa
ttctccgacgcggataaagcaattctcgatcaggccgatgcggcgctggaaacggcgcgt
aaagctatggacgaccaagcgctgcatctggcgctcggcgcgatcttcgccgttgtcgcg
gaagccaatcgttattttgcggggcaggaaccttgggcgctgcgcaagaccgatccggcg
cgcatgggtactgtcctttatgtgacagccgaagtgatccggcgcgttggcatcatggtg
cagccgttcattccgcagtcggcagaaaagcttctcgacatactggcaattcctgccgac
aagcgtcagttctctgacgttacggcaagccagcttgtcgggggtgccgatctgccagcc
ccgcagccggtatttccgcgctatgtggaaacagaagaacagaactga

DBGET integrated database retrieval system