KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2340Help
Entry
Oant_2340         CDS       T00568                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Brite
Enzymes [BR:oan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Oant_2340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD GCD14 Methyltransf_25 Methyltransf_23 Methyltransf_11 CMAS Fibrillarin Methyltr_RsmB-F Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ABS15054
UniProt: A6X1F0
Position
1:complement(2462259..2462927)
Genome map
AA seq 222 aa AA seqDB search
MRQAASERPRLSDREGFASFVMRMRGYGIDDPRLFAAIESTPRQSFLASSWSHLSYSSRT
APLDCGEYMEGIDDQARAIAALKLEPGHRVLEIGTGSGFTAAVMSSLAGRVTTVERYRKL
CDHALQQFVSLKRENIMVKHADGRHGMPGGPFDRILIWLAFDEVPRHFVDLLATHGVLIA
PIGPGDGRQIMTRIAKVGSRFEQEDLMVVRYQPFIEGVSSVL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaggcagcgtctgagcgcccacggctttcggacagagaaggattcgcatccttc
gttatgcgaatgcgcggatacgggattgacgatccgcgcctttttgcagccatcgagtcc
acaccacgccagagctttctcgcgtcgtcatggtctcatctttcctacagctcccgtact
gcgccgcttgactgcggcgagtacatggagggcattgatgatcaggctcgcgccatcgcc
gcgctcaagctggaacccggccatcgtgtgctggagatcggaaccggctccggtttcacg
gctgctgttatgtcttcgctcgccggtcgtgtcacaacggtcgaacgttatcgcaagctc
tgcgaccacgccttgcagcaattcgtgtcgcttaagcgcgaaaacatcatggtcaaacat
gccgatggtcgccatggaatgccgggtggcccctttgaccgcatcctgatctggcttgcc
ttcgacgaagtgccgcgtcatttcgttgatcttctggcaacgcatggcgtgctgatcgct
ccgatcggtccgggagatggccgacagatcatgacacgtatcgccaaggtcggcagccga
ttcgagcaggaggacctgatggtggtccgctatcagcctttcatcgagggcgtttcgtcc
gttctgtga

DBGET integrated database retrieval system