KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2838Help
Entry
Oant_2838         CDS       T00568                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Oant_2838
Enzymes [BR:oan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Oant_2838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ABS15546
UniProt: A6X2U2
Position
2:complement(116939..117883)
Genome map
AA seq 314 aa AA seqDB search
MTRKIGVVGSNMVDLITYVNRMPGPGETLEAPTFEIGCGGKGANQAVAAARLGADVMMVT
RVGDDIFADNTIRNLNEFGVDTRHVRKVPGKSSGVAPIFVEPSGENSILIVKGANADLLP
AEVDKAADDLKACGLILMQMEVPVETVYHTIAFAAENGIETILNPAPAAADLDPELIRQV
TFLVPNESELAILSGLPTGTDDEIVTAARSLIARGIRTVIVTLGGRGARMITASEIVNIP
PVKVTPKDTTGAGDAFIGSFARFYAGTGDVEASLRKAALYAAHSITRPGTQKAYASQEEF
ETFCRDHAPSTERA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaccagaaagatcggagtggtcggctccaacatggtggacctcatcacctatgtgaac
cgtatgcccggccccggcgaaacgctggaagccccgacatttgaaatcggctgtggtgga
aaaggcgccaatcaggccgtggctgccgcgcgccttggcgcagatgtgatgatggtcacg
cgtgtgggcgacgatatttttgccgacaataccatccgcaacctgaacgagttcggcgtc
gatacgcgccatgtgcgcaaggttcccggcaagtcgagcggtgtagcacccatcttcgtg
gaaccatcgggtgaaaactcgatcctgatcgtcaagggcgccaatgccgatcttctgcct
gccgaagtcgacaaggctgccgacgatctgaaagcttgcggcctcatcctgatgcagatg
gaagttccggtcgagacagtctaccacaccatcgctttcgccgctgaaaacggcatcgaa
accattttgaatcctgcgcctgctgccgccgaccttgatcccgaactgatccggcaggtg
acttttctcgtgccgaacgagagcgagcttgcgatcctctccggcctgccgaccggcacg
gacgatgagatcgttaccgctgcgcgttcgctcatcgcgcgcggcatccgcaccgtcatt
gtcacgctcggcggacgcggcgcacgcatgattaccgccagcgaaatcgtcaatattccc
ccggtcaaggtcacaccaaaagacacgaccggcgcaggcgacgcttttatcggctccttt
gcccgcttctacgccgggaccggcgatgtggaagcctcgcttcgcaaggccgctctttat
gcggcccattccatcacccggccgggcacgcagaaagcctatgccagccaggaagaattc
gaaacgttctgccgcgatcacgccccttcgaccgaacgtgcctga

DBGET integrated database retrieval system