KEGG   Ochrobactrum anthropi ATCC 49188: Oant_3032Help
Entry
Oant_3032         CDS       T00568                                 

Definition
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:oan00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Oant_3032
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:oan01007]
    Oant_3032
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oan03016]
    Oant_3032
Enzymes [BR:oan01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     Oant_3032
Amino acid related enzymes [BR:oan01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Oant_3032
Transfer RNA biogenesis [BR:oan03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Oant_3032
 Prokaryotic type
   Other AARSs
    Oant_3032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ABS15740
UniProt: A6X3D6
Position
2:337730..340642
Genome map
AA seq 970 aa AA seqDB search
MTETTKIDYSKTLYLPQTEFPMRAGLPQREPLFVERWEGMNLYKKLREQAKDRPLYVLHD
GPPYANGNIHIGHALNKILKDVITRSFQMRGYNSNYVPGWDCHGLPIEWKIEEKYRAEGK
NKDEVPINEFRRECREFATNWIKVQTEEFKRLAILGDFENPYTTMNFHAESRIAGELLKF
AASGQLYRGSKPVMWSVVERTALAEAEVEYHDVESDMIWVKFPVAGQNDLSGSDVVIWTT
TPWTIPGNRAVSYSSRIEYGLYEVTEAENDFGPRPGEKLIFADKLAEESFAKAKLQFKRL
RGISADELGKIVLDHPLKGFGGGYEFIVPMLDGDHVTDDAGTGFVHTAPSHGREDFEAWM
NNARELEARGIDPSIPFPVGDDGFYTKDAPGFGPDREGGPARVIDDNGKKGDANKSVVDQ
LIARDKLFARGRLKHSYPHSWRSKKQVIFRNTPQWFVYMDKNLGDGTTLRSRALKAIDDT
RFVPAAGQTRLRSMIEGRPDWVLSRQRAWGVPICVFVDEEGNILQDDAVNKRILDAFEAE
GADAWFAEGARERFLGSRANEGWTQVRDILDVWFDSGSTHTFTLEDRPDMKWPADVYLEG
SDQHRGWFHSSLLESCGTRGRAPYNAVVTHGFTMDEHGKKMSKSLGNTVTPQDVIKESGA
DILRLWVMTTDYWEDQRLGKSIIQTNIDAYRKLRNTIRWMLGTLAHDKGENLPYANLPEL
ERLMLHRLTELDEVVRSGYDAFDFKRIARTLIDFMNVELSAFYFDIRKDALYCDAPSSVR
RKAALQTVREIFDHLTTWLAPMLPFTMEEAWLDRYPQSVSVHAEQFRPTPAEWRDDVLAE
KWRKVRAVRRVVTGALELERADKRIGSSLEAAPLVYISDKSLTDSLEGLDFAEICITSGI
SLSDAAVPEDAFTLSDVKGVAVVPVRAEGEKCARSWRYTTDVGSDPEFPDVSARDAAALR
ELKALGKLEA
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgactgagacgaccaaaatcgattattccaaaaccctttatctgccgcagaccgagttt
ccgatgcgtgctggcttgccgcagcgcgagccccttttcgtcgagcgctgggagggaatg
aatctctacaaaaagctgcgcgagcaggcgaaagaccgcccgctttatgtgctgcacgat
ggcccaccctatgccaacggcaatatccatatcggccatgcgctgaacaagatcctcaag
gacgtcatcacccgctcgttccagatgcgcggttataactcgaactatgttccgggctgg
gattgccacggcctgccgatcgaatggaagatcgaggaaaaatatcgcgccgagggtaag
aacaaggacgaagtgccgatcaacgaattccgcagggaatgccgcgaattcgcgaccaac
tggatcaaggttcagacggaagagttcaagcgccttgccatcctcggcgatttcgaaaac
ccctatacgacgatgaacttccacgctgaatcgcgtatcgctggcgagcttctcaaattc
gcggcttccggtcagctttatcgcggctccaagccggtgatgtggtcggtcgtcgaacgc
acggcgcttgccgaagcggaagtcgagtatcacgatgtcgagtcggatatgatctgggtc
aagttcccggtcgccggccagaatgatctctccggcagcgatgttgtgatctggacgacc
acgccgtggaccattcccggcaaccgtgccgtgtcctattcgtcgcgcatcgaatacggg
ctttatgaagtcacggaagccgagaacgactttggccctcgcccgggcgaaaagctcatc
ttcgccgacaagctggctgaggaaagcttcgccaaggcaaagcttcagttcaagcgcctg
cgcggtatttcggcagacgagcttggcaagatcgtcctcgaccatccgttgaagggcttt
ggcggtggttatgaattcatcgtgccgatgcttgatggcgaccatgttaccgatgatgca
ggtacgggttttgtgcatactgctccaagtcacggccgcgaagactttgaggcatggatg
aacaatgcccgcgaactggaagcacgcggtatagatccaagtattccgttcccggtcggg
gatgatggcttttacaccaaggacgcgccgggcttcggtcctgaccgtgaaggtggtccc
gcgcgggttatcgacgataacggcaagaagggcgacgccaacaagtccgttgtggatcag
ctgatcgcacgcgacaagcttttcgcgcgtggtcgcctgaagcattcttatccgcattcg
tggcgttccaagaagcaggtcatcttccgcaacacgccgcagtggttcgtctatatggac
aaaaaccttggtgacggtacgaccttgcgttcgcgcgcgctgaaggccatcgacgatacg
cggttcgtaccggctgccggtcagacgcgcctgcgttcgatgatcgaaggccgcccggac
tgggtgctttcgcgccagcgcgcctggggtgtaccgatctgcgttttcgtggatgaagaa
ggcaacattctgcaggatgatgcagtcaacaagcgtatcctcgatgcttttgaggcagag
ggggcggacgcctggtttgccgaaggtgcccgcgagcgcttcctcggaagccgtgccaat
gaaggctggacgcaggtgcgcgacatccttgacgtttggttcgattccggttcgacgcac
accttcacgctggaagaccgtccggatatgaagtggccagctgatgtttatctggagggc
tctgaccagcatcgcggttggttccattcgtcgctgctggaaagctgcggtacgcgtggc
cgggcaccatataatgccgtcgtgacccatggtttcactatggatgagcacggcaagaag
atgtcgaagtcgctcggtaatacggtcacgccgcaggatgtcatcaaggaatccggtgcg
gatatcctgcgtctttgggtcatgacgaccgattattgggaagatcagcgcctcggcaag
agcatcatccagactaacatcgacgcttatcgcaagttgcgcaacacgatccgctggatg
ctgggcacgctcgctcacgataaaggcgaaaatcttccctatgcgaatttgccggaactt
gagcgcctgatgctgcaccggttgactgaattggatgaagttgttcgctctggatatgat
gctttcgacttcaagcgcatcgctcgcacgcttatcgacttcatgaatgtcgagctctcg
gccttctatttcgatatccgcaaggacgcgctttactgcgatgcgccgtcgagcgttcgc
cgtaaggcagcgttgcagactgtgcgtgaaatctttgatcacttgacgacctggctggcg
ccaatgctgcctttcaccatggaagaagcttggctcgaccgctatccgcaatcggtttcg
gttcatgccgagcagttccggccgacacctgccgaatggcgggatgatgtgctggcggaa
aagtggcgcaaggttcgtgcggtgcgtcgtgtcgttactggcgctctggaactggagcgt
gcggataagcgcattggatcgtcgctcgaagctgctccgctcgtctacatttccgacaag
agcttgaccgattcgctcgaaggtcttgattttgcggaaatctgcatcaccagcggtatt
tcgttgagcgatgcggctgtaccggaagacgctttcacgctttctgatgtgaaaggcgtt
gctgttgtgcccgtacgcgccgaaggtgaaaagtgcgcccgttcgtggcgttatacgacg
gatgttggttccgatcccgagtttcccgatgtctcggcgcgcgacgctgctgctctccgg
gaactcaaggcactcggcaagcttgaagcttga

DBGET integrated database retrieval system