KEGG   Ochrobactrum anthropi ATCC 49188: Oant_3107Help
Entry
Oant_3107         CDS       T00568                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00071  Fatty acid degradation
oan00072  Synthesis and degradation of ketone bodies
oan00280  Valine, leucine and isoleucine degradation
oan00310  Lysine degradation
oan00362  Benzoate degradation
oan00380  Tryptophan metabolism
oan00620  Pyruvate metabolism
oan00630  Glyoxylate and dicarboxylate metabolism
oan00640  Propanoate metabolism
oan00650  Butanoate metabolism
oan00900  Terpenoid backbone biosynthesis
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01120  Microbial metabolism in diverse environments
oan01130  Biosynthesis of antibiotics
oan01200  Carbon metabolism
oan01212  Fatty acid metabolism
oan02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Oant_3107
   00630 Glyoxylate and dicarboxylate metabolism
    Oant_3107
   00640 Propanoate metabolism
    Oant_3107
   00650 Butanoate metabolism
    Oant_3107
  Lipid metabolism
   00071 Fatty acid degradation
    Oant_3107
   00072 Synthesis and degradation of ketone bodies
    Oant_3107
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Oant_3107
   00310 Lysine degradation
    Oant_3107
   00380 Tryptophan metabolism
    Oant_3107
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Oant_3107
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Oant_3107
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Oant_3107
Enzymes [BR:oan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Oant_3107
Exosome [BR:oan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Oant_3107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABS15815
UniProt: A6X3L1
Position
2:complement(424060..425250)
Genome map
AA seq 396 aa AA seqDB search
MSNSDPIVIVGASRTPMGGFQGDFANAQATDLGAAAIRGALAGAGLAPEAVEDVYMGCVL
PAGQGQAPARQASIKAELPVSTGATTVNKMCGSGMKATMLAHDLLLAGSADVIVSGGMES
MTNSPYLLPKARGGYRMGHGQIIDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
EFAIASLTRAQNAITNGLFAAEITPVSVKAGRNEVEISIDEQPGKAKLDKIPTLRPAFRD
GGTVTAANSSSISDGAAALVLMRASEAEKRGLTPRAVLVGHATHADKPNLYPTAPIGAIN
KLSAKIGWNLKDVDLFEINEAFAVVTMAAMRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLSALETHGLKRGVAGICLGGGEATAVGIERIV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacagcgatcctattgtcattgtcggtgcttcccgtactcccatgggcggcttt
cagggcgattttgccaacgcccaggcgaccgatcttggtgccgccgccattcgcggcgca
cttgcgggcgcgggtcttgcaccggaagcggtcgaagatgtctatatgggctgtgttctg
cctgccggtcaggggcaggctccggcacgtcaggcctcaatcaaagccgaattgccggtt
tcaaccggcgcgacgacggtcaacaagatgtgcggctcaggcatgaaggcaaccatgctg
gcgcacgatctgctgctggcaggttctgccgatgtcatcgtgtccggcggcatggagagc
atgacgaactccccctatctgctgccaaaggcacgtggtgggtatcgtatgggacacggc
cagattatcgaccatatgttcctcgatgggcttgaagatgcctatgacaaaggtcgtctg
atgggcacctttgccgaagactgcgcggaagcctaccagtttactcgcgaagctcaggat
gagttcgccattgcctctctgacacgtgcgcagaatgctatcacgaacggccttttcgct
gccgaaattacccccgtttcagtgaaagctggacgtaacgaagttgaaatttccattgat
gagcagcccggcaaggcgaaactggacaaaattcccacccttcgcccggcatttcgtgat
ggcggcaccgtgacggctgccaattcctcctcgatttcggacggggcggcagcccttgtt
ctcatgcgtgcttccgaagcggaaaagcgcggcctcaccccacgtgcggttctggtcggc
catgcgacccatgccgacaagccgaatctctacccgaccgccccgatcggcgccataaac
aagctttcagcgaaaatcggctggaacctgaaagatgtcgatctctttgagatcaatgaa
gcttttgcggtcgtaaccatggcggccatgcgtgatcttgatctaccgcacgacaaagtc
aacattcatggtggcgcctgcgcccttggccaccccatcggcgcgtcaggggcgcgcata
cttgtcaccctgctttcagccctcgaaacccatggtctgaagcgcggtgttgctggcata
tgtctgggcggcggcgaagcgactgcggttggtatcgagaggatcgtctga

DBGET integrated database retrieval system