KEGG   Ochrobactrum anthropi ATCC 49188: Oant_3453Help
Entry
Oant_3453         CDS       T00568                                 

Definition
(GenBank) Formaldehyde dehydrogenase glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00625  Chloroalkane and chloroalkene degradation
oan00680  Methane metabolism
oan01100  Metabolic pathways
oan01120  Microbial metabolism in diverse environments
oan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Oant_3453
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Oant_3453
Enzymes [BR:oan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Oant_3453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABS16159
UniProt: A6X4K5
Position
2:810722..811912
Genome map
AA seq 396 aa AA seqDB search
MSKNRGVVYLRPGTVEVRDIEDPALAAPDGRKLDHAVILKVISTNICGSDQHMVRGRTTA
MPGLVLGHEITGEIIEKGSDVEMLDVGDIVSVPFNVACGRCRCCKSQDTGVCLTVNPSRA
GGAYGYVDMGGWIGGQARYVMVPYADFNLLKFPDREQAMEKIRDLTMLSDILPTGFHGAV
KAGVGVGSVVYVAGAGPVGLAAAASARILGAAVVMVGDFNKERLDHARKVGFEPIDLSAS
DRLGDMIAEVTGSNEVDSAIDAVGFEARGHSGGEQPAIVLNQMMEITRPAGAIGIPGLYV
TEDPGAVDNAAKQGSLSLRFGLGWAKAQSFHTGQTPVLKYNRQLMQAILHGRLNIAEIVN
AQVISLEDAAKGYESFDQGAAKKFVLDPHGLLSKVA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaccgtggcgtcgtttatttgcggcccgggacagtcgaagtgcgcgatatt
gaagatccagcgttagcggcaccggacgggaggaagctggaccacgccgttatattgaag
gtaatctcgacaaatatttgtggttccgaccagcatatggttcgcggacgcacgactgcg
atgcccggtctcgtgctggggcatgaaattaccggtgaaattattgaaaaaggcagcgat
gtcgagatgcttgatgtgggcgacatcgtttcagtcccgttcaatgtcgcttgtggtcgc
tgccgttgctgtaaatcccaggacacaggtgtttgcctgacggtcaacccgtcgcgtgcc
ggtggcgcctatggatatgttgatatgggaggctggattggcgggcaggcccgctatgtc
atggtgccctatgccgatttcaatctgctcaagttccccgatcgcgagcaagcgatggaa
aaaatccgcgacctgacgatgctttctgacatcttgccgaccggctttcacggtgcggtg
aaagccggcgtcggggttggttcggttgtatatgtcgcgggtgcgggaccggtggggctt
gctgctgcggcatccgctcgcattctgggcgctgcggtcgttatggtcggtgacttcaac
aaggaacggctcgatcacgcacggaaagtggggttcgaaccaatcgatctttcggcaagc
gatcgtctcggcgacatgattgcagaagtcacaggcagcaacgaagtggatagtgctatt
gatgctgttgggttcgaggcgcgcggtcatagcggtggcgagcaaccggcgatcgtgttg
aaccagatgatggagataactcgtcccgccggggcaatcggtattccggggctttatgtc
accgaagacccaggtgctgtcgacaatgctgcgaaacaaggcagcttgtcgttacggttt
ggcctcggttgggccaaggcgcagtcattccataccggacagacaccggttctgaagtac
aatcgccagctgatgcaggcgatcctgcatgggcgcctgaatatcgccgagatcgtaaac
gctcaggtcatttcacttgaggacgcggcaaagggctatgaaagtttcgatcagggcgct
gcgaagaaattcgttctcgatccgcatggccttttgagcaaggtggcttga

DBGET integrated database retrieval system