KEGG   Ochrobactrum anthropi ATCC 49188: Oant_3489Help
Entry
Oant_3489         CDS       T00568                                 

Definition
(GenBank) Homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00270  Cysteine and methionine metabolism
oan00920  Sulfur metabolism
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01130  Biosynthesis of antibiotics
oan01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oan00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Oant_3489
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Oant_3489
Enzymes [BR:oan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Oant_3489
    2.3.1.46  homoserine O-succinyltransferase
     Oant_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS DUF3364
Motif
Other DBs
NCBI-ProteinID: ABS16195
UniProt: A6X4P1
Position
2:851886..852806
Genome map
AA seq 306 aa AA seqDB search
MPIKIPDDLPATSVLQAEGVMVMREADAIRQDIRPLKIGLLNLMPNKVTTETQIARLLGA
TPLQVELTLVRITNHVARHTPADHMLSFYQPWEEVQDQRFDGFVITGAPVERLEFEEVTY
WDEMQRVFDWTQTHVHRSLNICWAAQAAVHHFHGMGKYELPGKASGVYSQRNLAPSSPYL
RGFSDDFKIPVSRWTEVRKSDIPAESELKVLVDSPETGLCLLDDPRHRALHMFNHVEYDT
TSLADEYFRDIQAQPETKVPANYFPGDDATRQPENRWRSHAHLLFGNWINEMYQSTPYDL
QNIGKR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattcctgacgatctgccagcaaccagtgttctccaggccgagggcgtt
atggtcatgcgtgaagcagatgccattcgtcaggatattcgtccgctgaagatcggcctt
ctcaatctgatgccgaacaaggtcacgacagagacgcagattgcgcgtctgcttggcgcg
acaccgttacaggtcgagcttacccttgttcgtatcaccaaccatgtggcgcgccatacg
cctgccgatcacatgctgtcgttctaccagccgtgggaagaggtgcaggaccaacgcttt
gacggttttgtcatcaccggtgctccggtcgaacgcctcgagttcgaggaagtcacctat
tgggatgagatgcagcgtgtcttcgattggacgcagacccatgtgcaccggtcactgaat
atatgctgggccgcacaggctgcggtccatcatttccacggcatgggcaagtacgagctg
ccgggcaaggcgtcgggcgtctatagccagcgcaatcttgcgccgtcgtctccctacctt
cgcgggttctcggatgatttcaaaatcccggtttcacgctggaccgaagtgcgcaagagc
gacattccagccgagagtgagctgaaggttttggtcgatagtccggaaacaggcctttgc
ctgctggacgatccacgtcatcgcgcgctgcatatgttcaatcacgtggagtacgacaca
acgtcgcttgccgatgagtatttccgcgacattcaggctcagcctgaaacaaaggttcca
gcgaactatttccccggagatgacgcgacgcgccagccggaaaaccgctggcgcagccac
gcacatcttctgtttggaaactggatcaacgagatgtatcaatcgacgccttacgacctg
caaaatatcgggaagcgttaa

DBGET integrated database retrieval system