KEGG   Ochrobactrum anthropi ATCC 49188: Oant_4032Help
Entry
Oant_4032         CDS       T00568                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00071  Fatty acid degradation
oan00072  Synthesis and degradation of ketone bodies
oan00280  Valine, leucine and isoleucine degradation
oan00310  Lysine degradation
oan00362  Benzoate degradation
oan00380  Tryptophan metabolism
oan00620  Pyruvate metabolism
oan00630  Glyoxylate and dicarboxylate metabolism
oan00640  Propanoate metabolism
oan00650  Butanoate metabolism
oan00900  Terpenoid backbone biosynthesis
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01120  Microbial metabolism in diverse environments
oan01130  Biosynthesis of antibiotics
oan01200  Carbon metabolism
oan01212  Fatty acid metabolism
oan02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Oant_4032
   00630 Glyoxylate and dicarboxylate metabolism
    Oant_4032
   00640 Propanoate metabolism
    Oant_4032
   00650 Butanoate metabolism
    Oant_4032
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Oant_4032
   00072 Synthesis and degradation of ketone bodies
    Oant_4032
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Oant_4032
   00310 Lysine degradation
    Oant_4032
   00380 Tryptophan metabolism
    Oant_4032
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Oant_4032
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Oant_4032
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Oant_4032
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oan04147]
    Oant_4032
Enzymes [BR:oan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Oant_4032
Exosome [BR:oan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Oant_4032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABS16736
UniProt: A6X682
Position
2:complement(1453516..1454724)
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSSAFEAGYDFKAPGIQISRFCASGLDAVNLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAAKS
WEKGYFKNSVISIKDQNGLTILDHDEHMRPTTDMQALGQLNPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKMNVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacaccgcgcggacgtggcaagaaggat
ggcagcctgcacgaagtgcctgccgttcgtctgggtgcgaaagttctggaatccctgcgc
gaccgcaacggtatcgacacggcaaaggtcgatgacattattttcggctgcgtcgacccg
gtcggtgaagctggtgcggtcatcccgcggtcgtcagcttttgaagccggttacgacttc
aaggcgccgggcatccagatttcgcgtttctgcgcctcgggcctcgatgcggtcaatctg
gcagcagccaaggtcgccttcggttccgacgatctggtgattgcaggcggcgtggaaagc
atgtcgcgtgtcggcatgggcatgtcgggcggtgcctggtacatggacccatcggtcggc
ttccccggctatttcatgccgcagggtgtttccgccgacttgatcgccacgaaatatggc
ttcagccgcgatgacgtcgatgcctatgccgtcgaaagccagaagcgtgccgccaagtcg
tgggaaaagggctatttcaagaactcggtcatttcgatcaaggaccagaatggcctgacc
attctcgatcatgacgagcatatgcgcccgacgaccgatatgcaggctctgggccagctc
aatccgtcctttgtgatgccgggcgaaatgggcggcttcaatgcggtcggcattcaggcc
cacccggaaatcgaaaccgtcaatcacgtccaccatgccggtaactcgtcgggcatcgtc
gatggtgcggctggcgttctggttggctccaggaaggctggcaaggccttcgacatcaag
ccgcgtgcgcgcattcgtgcttttgccaacatcggttccgaaccggcgctcatgctgacc
ggtccggtcgatgtgacggagaagcttctcaagcaggcgaagatgaaaatctcggacatc
gacctgtttgagctgaacgaagccttcgcggccgttgttctgcgctacatgcaggccttc
gacattccgcacgacaagatgaacgtcaatggcggtgccattgccatgggccatccgctc
ggtgcaaccggcgctatgatcctcggtacggtgctggatgaactggaacgccgcgatctc
aacaccgcactggtgaccttgtgcatcggtgccggcatgggcacggcgacaatcatcgag
cgcgtttaa

DBGET integrated database retrieval system