KEGG   Ochrobactrum anthropi ATCC 49188: Oant_4278Help
Entry
Oant_4278         CDS       T00568                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00260  Glycine, serine and threonine metabolism
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01120  Microbial metabolism in diverse environments
oan01130  Biosynthesis of antibiotics
oan01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oant_4278
Enzymes [BR:oan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Oant_4278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABS16978
UniProt: A6X6X4
Position
2:1714296..1715345
Genome map
AA seq 349 aa AA seqDB search
MHFASDNWAGAHPKIAESLSLHAAGFAAAYGASELDKRVEQRFNELFEREVAVYFVGTGT
AANSLALASVNRPGGVSLVHREAHVIEDECGAPEYFTGGARLHPIDGAHGRIDPELLKRE
LRRFNPAFVHAGQPMAVSITQATEVGTLYQPEHIATISKICRDAGLPLHMDGARFANALV
SLDMTPAEMTWKQGVDIVSFGGTKNGCWCAEALVFMDPARAKDLPFIRKRAAQLFSKTRF
VAAQFDAYLRDDLWLELARHSNALAARLAGHINASSQMRLAWKPEANEVFAIMKQSVYDR
LRNAGAIFYDWNPPHSEVNRISDGEIFARFVTSFANTEEDVDRFADLIA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgcattttgcgtcagacaattgggcaggcgcccacccgaaaatcgccgagagcctttcg
ttgcatgctgcaggttttgcggcagcctatggcgcaagcgaactcgacaagcgcgtcgag
cagcgcttcaacgaattgttcgagcgcgaagttgccgtgtactttgtcggaacaggaaca
gccgccaactcgctggcgctggccagcgtcaaccggcccggcggagtttcgctggtgcac
cgcgaagcgcatgtgatcgaggacgagtgcggtgcacctgaatatttcaccggcggcgca
cgtctgcatccgattgacggtgcgcatggccgcatcgaccccgaacttctcaagcgcgaa
ctgaggcggttcaatccggctttcgttcatgctgggcagcccatggccgtcagcatcacg
caggcgaccgaagttggtacgctctaccagcccgaacatatcgccaccatttccaagatc
tgccgcgatgccggtctgccactgcatatggacggcgcacgctttgccaatgcgcttgtt
tcgctggacatgacaccagccgaaatgacctggaaacagggcgtggacatcgtttccttc
ggaggtacgaaaaacggctgctggtgcgccgaagcattggtcttcatggacccggcccgc
gccaaggacctaccgttcatccgcaaacgcgcggcacagctcttttccaagacacgcttt
gtggcagcgcaattcgatgcttacctgcgagacgatctctggctggaactggcacgtcac
tccaatgcactcgccgcgcgcctcgccggtcatatcaatgcgtcgagccagatgcgcctt
gcctggaaaccggaagccaatgaggtcttcgccatcatgaaacagtcggtctatgatcgt
ctgcgcaatgccggagcgattttctacgactggaaccccccgcattcggaagtgaaccgc
atcagcgacggcgaaattttcgcccgctttgtgacgagcttcgccaacacggaagaagat
gtcgaccggttcgctgacttgatcgcctga

DBGET integrated database retrieval system