KEGG   Ochrobactrum anthropi ATCC 49188: Oant_4346Help
Entry
Oant_4346         CDS       T00568                                 

Definition
(GenBank) Nitrous-oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00910  Nitrogen metabolism
oan01120  Microbial metabolism in diverse environments
Module
oan_M00529  Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Oant_4346
Enzymes [BR:oan01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Oant_4346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2 Cu-oxidase_2 Cu-oxidase_3
Motif
Other DBs
NCBI-ProteinID: ABS17046
UniProt: A6X742
Position
2:complement(1774854..1776770)
Genome map
AA seq 638 aa AA seqDB search
MSEETKKTQLSRRQLLGSSAFVAAAGAGGLGGALFAGSTEPAIAAAGGAGHSAEVKPGEL
DEYYVFFSSGQSGEVRIVGLPSMRELMRIPVFNRDSATGWGQTNESLKVLTEGLLPQDQE
FLKDRGGIFLNGDLHHPHPSFTEGTYDGRYLYANDKANTRVCRIRLDVMKCDKIIQLPNQ
HTVHGLRVQKYPKTGYVFCNGEDRAPIPNDGSNLTDTKQYHAIFTAVDGETMKVAWQIMV
DGNLDNVDCDYQGKYAFATCYNSEEGTTLAEMMSSEQDWIVIFNLKRIEEAVAKGDFKEI
NGVPVIDGRHGSKYTRYIPVPNSPHGINTAPDGIHVVANGKLSPTVTVFDVRKFDELFDD
KIKPRDAVVAEPELGLGPLHTAYDGKGNAYTTLFIDSQICKWNIEDAKRAFKGEKVDPIR
QKLDVHYQPGHNHTSMGQTKEADGQWLISLNKFSKDRYLNVGPLKPENDQLIDISGEKMM
IVHDGPSFAEPHDATIVHRSKINPVNFWSREDPFFADAVTQAKADGLDLMDANEVIRDGN
KVRVYMTSAAPAFGLTEFTVQQGDEVTVYVTNIDEIEDLTHGFAIINYGVNMEIGPQATA
SVTFTANKPGVWWYYCSWFCHAMHMEMKGRMLVEPKKA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaaaccaaaaaaacgcagcttagtcgaagacagctgctcggctcgtcagcc
tttgtggctgctgccggtgcaggcggtcttggtggagcgctgtttgcaggttcaaccgaa
ccggcaatagctgctgccggcggtgctggccacagtgcagaggtgaagcctggagaactg
gacgaatattacgtcttcttttccagcggtcagagcggtgaggtccgtattgtcggcttg
ccgtcgatgcgcgaactgatgcgcattccggtgttcaatcgcgatagcgcgaccggctgg
ggccagacaaatgaaagccttaaggtgctgaccgaaggccttctgccgcaggaccaagag
ttcctcaaagatcgcgggggcattttcctgaatggtgacttgcaccacccgcacccgtcc
ttcacggaaggcacctatgacggacgctatctctacgccaacgacaaggccaatacgcgt
gtctgccgcatccgtcttgatgtgatgaaatgcgacaagatcattcagctcccgaaccag
cacaccgtgcatggcttgcgcgtgcagaaatatccgaaaaccggatatgtcttctgcaac
ggtgaagatcgcgcgccgatcccgaacgacggcagcaatctgaccgataccaagcaatat
cacgcgatcttcacggccgttgacggcgagaccatgaaggttgcctggcagatcatggtc
gatggcaatctcgacaatgtcgactgcgattatcagggcaaatatgcttttgccacctgc
tacaattcggaagagggtacgacgctcgccgaaatgatgtcgagcgagcaggactggatc
gtcatcttcaacctgaagcgtatcgaagaagcggttgccaagggtgatttcaaggaaatc
aacggtgtgccggtcatcgatggacgtcacggttccaaatatacgcgttacattcctgtg
ccgaacagcccgcatggcatcaacactgcgccagacggtatccatgtggttgccaacggc
aagctctcgccgaccgttaccgtgttcgacgttcgcaagttcgatgagcttttcgacgac
aagatcaagccccgcgatgcagtcgttgcggaacctgaactcggacttgggccattgcat
acggcttatgatggcaagggcaacgcctatacaacgctcttcatcgacagccagatctgc
aaatggaatatcgaggacgccaagcgagccttcaagggtgaaaaggtcgatccgatccgt
cagaaactcgatgtgcattatcagcccggtcacaatcacacttccatggggcaaaccaag
gaagccgacggtcagtggctgatttcgctcaacaagttctccaaggatcgctatctcaat
gtcggcccactcaagccggaaaatgaccagctcatcgatatttccggtgagaagatgatg
attgtccatgacgggccaagttttgctgagccgcacgatgcaacgattgttcatcgttcc
aagatcaatcccgtcaacttctggagccgtgaggatccattcttcgccgatgctgtcact
caggcgaaagccgatggcctcgacctgatggacgcgaatgaggtgatccgggatggcaat
aaggtgcgcgtttatatgacgtctgccgcgccagccttcggtctaaccgagttcaccgtc
cagcagggcgatgaggtgacggtgtatgtcaccaatatcgacgagatcgaagatcttacg
cacggcttcgccatcatcaattacggggtcaacatggagatcgggccacaggcgaccgcg
tctgtcaccttcacggccaacaagccgggcgtgtggtggtattactgctcgtggttctgc
cacgccatgcacatggaaatgaagggccggatgctcgtggaaccgaagaaggcctga

DBGET integrated database retrieval system