KEGG   Brucella anthropi ATCC 49188: Oant_4561
Entry
Oant_4561         CDS       T00568                                 
Name
(GenBank) Lytic transglycosylase catalytic
Organism
oan  Brucella anthropi ATCC 49188
SSDB
Motif
Pfam: SLT SLT_2 SLT_4
Other DBs
NCBI-ProteinID: ABS17248
UniProt: A6X7P4
Position
pOANT01:complement(97103..98185)
AA seq 360 aa
MMHKKSALCIFLASATMPLSAWAGGVPVIDGSNLSERTVRDQKTSEIEKTDKDRFSLNKS
VTCAVYRPGRKDDPVAAAKANPEISGLVKRVAREEGVDENLFLGLVYQESRFNPCAKSGV
GAIGLAQLMPDTAKELGVDPHNIEQNLRGGARYLKQQLKRFNGNANLALAAYNAGAGNVK
KYGGIPPFKETQGYVRNITQKWTPAFGGSKDLPMNYGGGDTAYSGMRDSTINSMATTQAT
QESTANVASWLQQLGGMQSGTIQDSWDHNAGARNANLEMVNQVIVLGNSMADLLNSRNAV
SASGISGASQSASFKKKDDKPRETTGVCDPRTGLEWNAEEKACVQKREREANIKLNLDPQ
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgatgcataagaagtctgcattatgcatatttttggcgtcagcaaccatgccattgtcg
gcgtgggctggtggcgttcctgtcattgacggatctaatttgtccgaacgaacggtccgg
gatcaaaaaacatcggaaatcgagaaaacggataaagaccggttttcgctcaacaaaagt
gtgacctgcgctgtctatcgtccggggcgcaaggatgatcccgttgcagccgccaaagcc
aatccggaaatttccgggttggtcaaacgagtggcacgcgaagagggtgtagacgaaaat
ctatttctagggctcgtttatcaggaaagccgctttaatccatgcgcgaaatcgggtgtg
ggggctatcggtttggcacagttgatgcctgataccgcaaaagagttgggcgtagatccg
cataacattgaacagaacctccgcggtggtgctcgttatcttaaacagcagctcaagcgt
tttaacggcaacgccaacctcgcccttgcagcgtacaatgctggcgctggcaacgttaaa
aaatacggcggcattccaccgttcaaagaaacgcaagggtacgtccggaatatcacgcag
aaatggacaccggcgttcggtgggtcaaaggacctgcccatgaattacggcggcggtgat
acagcatattccggtatgcgggattcgaccatcaattcgatggcaacgacgcaggcgaca
caggaaagtaccgccaacgtcgcctcatggcttcaacagctcggcggtatgcagtccggc
acaattcaagacagttgggatcacaacgccggcgctcgaaatgcaaatctcgaaatggtc
aaccaggtgattgtcctcgggaattcaatggccgacctgctcaacagccgcaatgcagtt
tcagccagtggcatttcgggcgcatctcaatcggcttcgttcaagaagaaagacgacaag
ccgcgagaaacgaccggcgtctgcgatccccgtaccggtctcgaatggaatgctgaagaa
aaagcctgcgttcaaaagcgtgaacgcgaggcgaacatcaaactcaaccttgatcctcaa
taa

DBGET integrated database retrieval system