KEGG   Olleya aquimaris: DZC78_02990Help
Entry
DZC78_02990       CDS       T05582                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
oaq  Olleya aquimaris
Pathway
oaq00260  Glycine, serine and threonine metabolism
oaq01100  Metabolic pathways
oaq01110  Biosynthesis of secondary metabolites
oaq01120  Microbial metabolism in diverse environments
oaq01130  Biosynthesis of antibiotics
oaq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oaq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DZC78_02990
Enzymes [BR:oaq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DZC78_02990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_3 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AXO79389
Position
complement(659655..660674)
Genome map
AA seq 339 aa AA seqDB search
MIIDLRSDTVTKPSLEMMEAMMTAKVGDDVYKEDETINALEEKVAQQFGKSHAMFFPSGT
MANQTALKLHTNPGDQVICDQYAHIYNYEGGGASFNSGISCKLLDGHRGMFTASQVEEAI
NPPEFYHSPLTTLVEIENTTNKGGGACWDFNEILKIKDLCKTHNLGFHLDGARLWNALVA
KNETTAQYGAAFDTISVCLSKGLGCPIGSVLVGDEAIMKNAIRIRKILGGGMRQGGFLAA
AGLYALEHNIERLEEDHIKAKQLGDVLLKSSFVKKVEPVETNIVIFQLNEKYSENDFLEV
LSDKNIKIISMGNGKLRLVTHLNYSDNQHDKVVNVLKKL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatttaagaagtgataccgttacaaaacctagtttagaaatgatggaagcc
atgatgacagctaaggttggtgatgatgtgtataaagaggacgaaactattaatgctcta
gaagaaaaagtagcccaacagtttggcaagtcacacgctatgttttttcctagtggtacg
atggctaatcaaactgctttaaaactacatactaatcctggagatcaagttatatgtgac
cagtatgctcatatatataattatgaaggtggaggagcctcatttaatagtggtatttct
tgtaaattattagatggtcatagagggatgtttactgctagtcaagttgaagaagctatt
aatcctcctgaattttaccatagtcctttaacaactttagttgaaattgaaaatactact
aataaaggaggaggagcgtgttgggattttaatgaaattttaaaaattaaagacctttgt
aaaactcataatttagggtttcatttagatggagcaagattatggaatgctttagttgct
aaaaatgaaactacagcacaatatggagctgcttttgataccatatctgtttgtcttagt
aaaggattgggttgtccaattggatctgtacttgttggtgatgaagcaatcatgaaaaat
gctataagaattagaaagatcttaggaggaggaatgcgtcaaggtggatttttggcagca
gcaggattatatgcactagaacataatattgaaaggttagaagaggaccatataaaagcc
aaacaattaggtgatgttttacttaaatcttcctttgtaaaaaaggtcgaacctgttgaa
actaatattgtaatttttcaacttaatgaaaaatattcagaaaatgattttttagaggtg
ctttctgacaagaatattaaaatcattagtatgggaaatgggaaattaagattagtaacc
catcttaattattctgataatcagcacgataaagtcgttaatgtgctgaaaaagttgtaa

DBGET integrated database retrieval system