KEGG   Olleya aquimaris: DZC78_03905Help
Entry
DZC78_03905       CDS       T05582                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
oaq  Olleya aquimaris
Pathway
oaq00860  Porphyrin and chlorophyll metabolism
oaq01100  Metabolic pathways
oaq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oaq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DZC78_03905 (hemN)
Enzymes [BR:oaq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     DZC78_03905 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C DUF2420
Motif
Other DBs
NCBI-ProteinID: AXO79569
Position
849814..851178
Genome map
AA seq 454 aa AA seqDB search
MCVSLVNKYNVSGPRYTSYPTVPYWDPEAFSLKQWKQNLKKAFDQSNSTEGISLYIHLPF
CESLCTFCGCNKRITKRHDVEIPYIKAIIKEWQLYCDLLVEKPVIKELHLGGGTPTFFDS
ENLKLLINSIKHHAILAENYEFSFEGHPNNTTKDHLQTLYNLGFNRVSFGVQDYNPEVQK
AIHRVQPFENVKQVTQLAREIGYTSISHDIIFGLPFQTEAHVKETITKTKALLPDRIAFY
SYAHVPWIKGNGQRGFNDNDLPSAESKQNQYQLGKQLLTEAGYHDIGMDHFALPTDALYK
ASQSKTMHRNFMGYTASKTKVMIGLGVSSISDSWYAFAQNVKSIESYYDLLENNCIPVYR
GHILNQEDLIIRQHILNLMCNFETNWIAEDLNFKDLPEIIYKLKEMQDDGLLIFESQQII
ITEKGKPFVRNICMAFDVLLQRNKPETQLFSMTV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgtctcgttagtcaataaatataatgtttctggtcctagatatactagctatccg
acagttccgtattgggatccagaagctttttcattaaaacaatggaaacaaaatttaaaa
aaagcatttgaccaaagcaatagcactgaaggtattagtttatacatacaccttcctttt
tgcgaaagtctttgtacgttttgtggttgtaacaaacgaataactaaacgtcacgatgta
gaaataccatacataaaagcaattataaaagagtggcaattatattgtgatttattggtt
gaaaaacctgtaataaaagagcttcatcttggaggtggaactccaactttttttgactct
gaaaacttaaaactattaattaatagtataaaacatcatgctattcttgctgaaaattat
gagtttagttttgaaggtcatcctaataatacaactaaagatcatttacaaactttatat
aatctaggttttaatcgtgttagttttggtgtacaagattataatccagaagtacaaaaa
gcaatacatcgtgttcaaccatttgaaaatgtaaaacaagtcacacaattagcacgtgag
attggttatacatccattagtcatgatattatttttgggttaccttttcaaacagaagcc
catgtaaaagaaactattactaaaactaaagcactactaccagatcgcattgcattttat
agttatgcacatgtcccttggattaaaggcaatggtcagcgtggttttaatgacaacgat
ttaccttcggctgaaagcaaacaaaaccaataccaattaggaaaacaattattaacagaa
gctggctatcatgatattggtatggatcattttgctttaccaacagacgcactttataaa
gccagtcaatccaaaaccatgcatcgcaattttatgggttacacagcctctaaaactaaa
gtaatgattggtcttggagtgtcttctataagtgatagttggtatgcttttgcacaaaat
gtaaaaagtattgagtcttattacgacctattggaaaacaactgcatacctgtatataga
ggtcatattttaaatcaagaagacttaataattagacaacacattttaaatttaatgtgt
aattttgaaacaaattggattgctgaagacttaaattttaaagacttaccagaaattatt
tataagttaaaagaaatgcaagacgacggtttattaatttttgaatcacaacaaataata
attacagaaaaaggaaaaccttttgtacgtaatatatgtatggcttttgatgtactgttg
caacgtaacaaaccagaaacacaactattttcaatgacagtttag

DBGET integrated database retrieval system