KEGG   Olleya aquimaris: DZC78_07535Help
Entry
DZC78_07535       CDS       T05582                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
oaq  Olleya aquimaris
Pathway
oaq00860  Porphyrin and chlorophyll metabolism
oaq01100  Metabolic pathways
oaq01110  Biosynthesis of secondary metabolites
oaq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oaq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DZC78_07535 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:oaq01007]
    DZC78_07535 (hemL)
Enzymes [BR:oaq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     DZC78_07535 (hemL)
Amino acid related enzymes [BR:oaq01007]
 Aminotransferase (transaminase)
  Class III
   DZC78_07535 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AXO80242
Position
complement(1609351..1610628)
Genome map
AA seq 425 aa AA seqDB search
MIYKRSSALFAEAEQVIPGGVNSPVRAFKAVGGTPIFVKQAKGAYLYDEDDNKLIDYIAS
WGPMILGHAHQPVVDAVIDKAKKGTSFGMPTQIETQIAELAVSMVPNIDKIRFVNSGTEA
CMSAVRLARGYTKKDKIIKFAGCYHGHSDSFLIQAGSGAVTFGTPNSPGVTQGTAKDTLL
AKYNDLANVEALIEANKNEIACIIIEPVAGNMGCIPPKKGFLEGLRQLCDANNILLVFDE
VMTGFRLAKGGAQELLGIKADIVCFGKVIGGGLPVGAFAAKAEIMNHLAPLGPVYQAGTL
SGNPLAMAAGLAMLTELNTGDVFESLAKKTEYLHKGIAEVLEKRNVTHTINRVGSMISVH
FCDNEVVDFETSAKGNNDTFKTFFHGMLKQGVYLAPSAFESWFLNDALSYDDLDKTIAAC
DAVFS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgatttataaacgtagtagtgctttgtttgcagaagcagagcaagtaatacctggagga
gtaaactctcctgtaagagcttttaaagcagtaggcggaacaccaatatttgttaaacaa
gcaaaaggcgcttatttgtatgatgaagatgataataaactaatagattacatcgcatct
tggggaccaatgattttaggtcatgcacatcaacctgtagtagatgcagtaattgataaa
gcaaaaaaaggaacttcctttggtatgccaactcaaattgaaactcagatagcagaatta
gctgtgtcaatggttccaaatattgataaaatacgttttgttaattctggtacagaagct
tgtatgagtgctgttagattagcaagagggtatactaaaaaagacaaaataattaagttt
gctggttgctaccatggacattcagattcttttttaattcaagcaggaagtggagcagta
acctttggtactccaaatagtcctggagtgactcaaggtacagcaaaagatactttgctt
gcaaaatataatgatttagcaaatgttgaagctttaatagaagctaataaaaacgaaatt
gcttgtattattatagagcctgttgctggaaacatgggttgtattcctcctaaaaaagga
tttttagaagggttaagacaattatgtgatgctaataatattttattagtttttgatgag
gtaatgacagggtttaggttagctaaaggaggtgctcaagaattattaggtattaaagca
gatatcgtttgttttggtaaagtaattggaggcggattaccagttggagcttttgcagct
aaagctgaaatcatgaatcatttagcacctttaggtccagtgtatcaagctggaacatta
agcggaaatccattagctatggctgcaggtttagccatgttaaccgaactaaatactgga
gatgtttttgaaagtttagctaaaaaaacagaatacttacacaaaggaattgctgaggtt
ttagaaaaacgaaatgttacacatactattaatagagtaggctctatgatatctgtacat
ttttgtgacaatgaagttgtagattttgaaacgtctgcaaaaggtaacaacgatacgttt
aagaccttttttcatggtatgttaaaacaaggtgtttatttagcaccaagtgcatttgaa
agttggtttttaaatgatgcattgtcttatgatgatttagataaaaccatagcagcatgt
gatgctgtgtttagttaa

DBGET integrated database retrieval system