KEGG   Octadecabacter arcticus: OA238_160p1440Help
Entry
OA238_160p1440    CDS       T02539                                 

Definition
(GenBank) thiolase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oar  Octadecabacter arcticus
Pathway
oar00071  Fatty acid degradation
oar00072  Synthesis and degradation of ketone bodies
oar00280  Valine, leucine and isoleucine degradation
oar00310  Lysine degradation
oar00362  Benzoate degradation
oar00380  Tryptophan metabolism
oar00620  Pyruvate metabolism
oar00630  Glyoxylate and dicarboxylate metabolism
oar00640  Propanoate metabolism
oar00650  Butanoate metabolism
oar00900  Terpenoid backbone biosynthesis
oar01100  Metabolic pathways
oar01110  Biosynthesis of secondary metabolites
oar01120  Microbial metabolism in diverse environments
oar01130  Biosynthesis of antibiotics
oar01200  Carbon metabolism
oar01212  Fatty acid metabolism
oar02020  Two-component system
Module
oar_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:oar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OA238_160p1440
   00630 Glyoxylate and dicarboxylate metabolism
    OA238_160p1440
   00640 Propanoate metabolism
    OA238_160p1440
   00650 Butanoate metabolism
    OA238_160p1440
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OA238_160p1440
   00072 Synthesis and degradation of ketone bodies
    OA238_160p1440
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OA238_160p1440
   00310 Lysine degradation
    OA238_160p1440
   00380 Tryptophan metabolism
    OA238_160p1440
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OA238_160p1440
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OA238_160p1440
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OA238_160p1440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oar04147]
    OA238_160p1440
Enzymes [BR:oar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OA238_160p1440
Exosome [BR:oar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OA238_160p1440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGI74947
UniProt: M9RS35
Position
pOA238_160:complement(145992..147161)
Genome map
AA seq 389 aa AA seqDB search
MTDPYIVGWAHTAFGRSDAPDTEALMAEVTGPALDHAGVAVEDVDGIFVGVFNNGFSDQD
FQGALVGMGNDALSRVPATRYENACATGSAALNGAMDFIASGRGKIALVVGAEKMTATPG
VEVGDILLGASYRREESGVRGGFAGLFGQIAGSYFQRYGDRSEELAMIAAKNHHNGMQNP
FAHMQRDFDVDFCNTVSEKNPLVAGPLRRTDCSLVSDGAAALVLAAPEVAADLHRAIRFR
ARTHTNEPLALSRRDITRFDGARRAWDQAYAAAGVTIDDLSLVETHDCFTVAELLEYEAM
GLAEPGQGGRAIREGWTTKDGRLPVNPSGGLKSKGHPVGATGVSMHVMAAMQLMGEAGGM
QIPDARLVGVFNMGGAAVASYASILERVA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacagacccctacattgtgggctgggcccacaccgcatttggccgcagcgacgcgccg
gacacggaggcgctcatggccgaggtcacaggccctgcgctggaccatgcgggtgtcgcg
gtggaggacgtcgatggcatctttgtcggtgtcttcaacaacggcttttcggatcaggat
tttcagggtgcgctggtgggcatgggcaacgacgctttgtcccgtgtgccggcgacccgt
tatgaaaatgcctgcgccaccgggtccgctgcgctgaacggggcgatggatttcatcgcc
agcgggcggggcaagatcgcgcttgtcgtgggggctgagaagatgaccgccacgccgggg
gtggaggtcggtgacatcctgctcggcgcctcttaccggcgcgaggaatccggcgtgcgc
ggcgggtttgccggactgttcggacagatcgcgggtagttatttccagcgctacggcgac
cggtctgaagaactggcgatgatcgctgccaaaaaccaccacaatgggatgcagaaccct
ttcgctcacatgcagcgcgatttcgacgtggacttctgcaacactgtgtccgaaaaaaat
ccccttgtcgccggccccctgcggcgcacggattgttcgttggtgtccgacggggcggcc
gcactggtgctggcggcacccgaggtcgcggcggacctgcatcgcgcgatccgcttccga
gcgcggacccataccaacgaaccgctggccctttcgcgccgcgatattacccgcttcgac
ggcgcacggcgggcgtgggatcaggcctatgccgccgccggcgtgaccatcgacgaccta
agcctcgtggaaacccacgactgcttcacggtcgccgaactgctggaatacgaggcgatg
gggctggcggagccggggcagggcggtcgggcgatccgcgaaggatggacaaccaaggac
gggcggttgccggtgaacccttcgggcgggttgaagtccaaggggcatcccgtcggggcg
accggcgtgtcgatgcacgtgatggccgcgatgcagctgatgggcgaggcggggggaatg
cagatccccgatgcgcggctggtcggcgtgttcaacatgggcggagcggcggttgcctcc
tatgcctcgatcctcgaaagggtcgcgtga

DBGET integrated database retrieval system