KEGG   Octadecabacter arcticus: OA238_c30910Help
Entry
OA238_c30910      CDS       T02539                                 

Gene name
algA
Definition
(GenBank) alginate biosynthesis protein AlgA
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
oar  Octadecabacter arcticus
Pathway
oar00051  Fructose and mannose metabolism
oar00520  Amino sugar and nucleotide sugar metabolism
oar01100  Metabolic pathways
oar01110  Biosynthesis of secondary metabolites
oar01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:oar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    OA238_c30910 (algA)
   00520 Amino sugar and nucleotide sugar metabolism
    OA238_c30910 (algA)
Enzymes [BR:oar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     OA238_c30910 (algA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     OA238_c30910 (algA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 Cupin_1
Motif
Other DBs
NCBI-ProteinID: AGI73093
UniProt: M9RMX2
Position
complement(3274255..3275697)
Genome map
AA seq 480 aa AA seqDB search
MSHPDIVPVILCGGSGTRLWPLSRKSYPKQFTQLIGDHSLYQQAAARLTCEGFVAPVIVT
NSDFRFIVTQQLSAIGIDPGTVLIEPEARNTAPALLAAAIVIAQNPDALILASPSDHYIQ
DASQFRDSVRKGATAAAAGQIVTFGITPTRPETGYGYLELDEGAATDADATPLKGFVEKP
DSQNAARMIAEGRFLWNSGVFLYSARTLMDAFRTHAPELFENVQSAVTQARSDLGFLRLD
AQAWARCDDVSVDFAIMERADNLSVVTHPGDWSDLGGWEAVRQHMDLDDAGVGTHGAALA
VECRETLLRSENDSLQLVGLGLDNIVVVAMKDAVLVADRNHVADLGEVVKQMRVQQIAQA
DTSPRDFRPWGFFETLTLRDRFQVKRIVVNPGAALSLQSHVHRSEHWIVVAGTARVTVDD
EVKLVSENQSVYVPLGVVHRMENPGKVAMELIEVQTGTYLGEDDIIRYKDVYARGQGAKG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatcctgatattgtcccggtcattctttgtggtggttcaggcactcgcctgtgg
cctctgtcgcgaaaaagctatccgaaacagttcacgcaactgatcggggatcacagcctt
taccaacaagcagctgcgcggctgacgtgtgaggggttcgtggcgccggtgatcgtcacc
aattctgatttccggttcatcgtcacgcagcaattgtccgctatcggcattgatcccgga
acagttctgatcgaacctgaggcgcgcaacaccgcgcccgccttactggctgcggccatc
gtcatcgcccaaaatcccgatgcgctgatccttgcctctccgtctgatcactatattcag
gatgcgtcgcagtttcgcgacagtgtgcgcaagggggccacggctgccgccgccggacag
attgtcaccttcggcatcactccgacgcggcctgaaaccggatacgggtatcttgaattg
gacgagggtgccgcaactgacgccgatgctactccgttgaaagggtttgtcgagaaaccc
gattcccagaatgcggcccgaatgatcgccgaaggccggttcttgtggaactccggtgtg
ttcctttattccgcgcgcaccttgatggatgcatttcgcacccatgcacccgaattgttc
gagaatgtgcaatcggcagtgactcaggcgcgctcggatcttgggtttttgcggctggat
gcgcaagcttgggcacgctgtgatgacgtttccgtcgattttgcaatcatggaaagagcc
gataacctgtccgttgtgacccaccccggcgactggtccgaccttggcggttgggaggct
gtgcgccagcatatggaccttgacgacgctggtgttggcacccacggtgcggcccttgcg
gtcgagtgtcgcgaaacactgttacgcagcgaaaacgatagcctacaactggtcggcctt
gggcttgataacatcgtcgtcgtcgcaatgaaggatgcggtgctggtcgccgatcgaaac
cacgttgcggatctgggcgaggtcgtgaaacagatgcgcgtgcaacagatcgcgcaggcc
gacacgtccccgcgcgatttccgtccttggggatttttcgagaccctgaccctacgggac
cgctttcaggtcaagcggatcgtcgtcaaccccggtgccgcgctgagcctgcaaagccac
gttcaccgttccgaacactggatcgtggtggcgggcacggcgcgggtgacggtggatgac
gaggtgaaactggtgtccgaaaaccagtctgtctatgtcccgcttggcgtggtgcatcgc
atggaaaaccccggcaaggtcgcgatggaattgattgaggtgcagacaggaacctacctc
ggcgaagacgatatcatacgctataaggacgtttacgcacgcgggcagggggccaagggt
taa

DBGET integrated database retrieval system